DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and snt-4

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_491853.2 Gene:snt-4 / 172346 WormBaseID:WBGene00004924 Length:381 Species:Caenorhabditis elegans


Alignment Length:332 Identity:104/332 - (31%)
Similarity:172/332 - (51%) Gaps:35/332 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GGSGASQTKPQIISSVGNPGDGTTK---------DSANKSISMTDMYLDSTDPSENVGQIHFSLE 156
            |..|..|:...:.|.:.|  |.|..         :...:.:|.:::      |||. |.|.|:|.
 Worm    65 GPGGLKQSPSPLQSPLSN--DSTPSPVVPLQNLLEDRTRKLSPSEL------PSER-GNISFTLS 120

  Fly   157 YDFQNTTLILKVLQGKEL----PAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFY 217
            ||....||::.::..:.|    .::|.....||||::.|||:::||::|:|.|.|.:|.:.|.|.
 Worm   121 YDSHTLTLLVSIINCRNLCEMVVSRDGQCLLDPYVKLQLLPEREHRVKTRIVRSTTSPVYEEQFA 185

  Fly   218 FEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFA--GKQSFWKALKPPAKDKC--- 277
            ..|...:::....||..|..:||:|||..:||....|...:..  .:......|.|.|.|..   
 Worm   186 MYGVTHEQVNFATLHFQVVAFDRYSRDTVVGECVYRLADAELQVHNEMRVELPLLPRATDTVAAR 250

  Fly   278 GELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWL-QFGDKRVEKRKTPIFTCTLNP 341
            ||||.||.|..:.:.||:.::|||.|..::..|.:||:||::| :...:|:.|::|.:...||||
 Worm   251 GELLLSLTYQAAFNNLTVVVLKARGLGGRNDAGTADPFVKLYLRKESGERIVKKRTHVRRSTLNP 315

  Fly   342 VFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQT 406
            |:||||.|.:|.:::....:|:.|::.|.:.||::|||.||       ..|..|..:::..|.:.
 Worm   316 VYNESFVFELPDDRLEHSVIDLQVINHDRVNRNDVIGRALL-------NMEDSHVVEVLENPGRQ 373

  Fly   407 VVQWHRL 413
            |.|||.|
 Worm   374 VAQWHHL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 39/129 (30%)
C2B_Synaptotagmin-7 277..414 CDD:176050 51/141 (36%)
snt-4NP_491853.2 C2A_Synaptotagmin-4-11 111..241 CDD:176034 40/130 (31%)
C2 250..381 CDD:301316 51/138 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.