DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and Y48G8AR.2

DIOPT Version :10

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_490838.3 Gene:Y48G8AR.2 / 171702 WormBaseID:WBGene00021693 Length:339 Species:Caenorhabditis elegans


Alignment Length:134 Identity:27/134 - (20%)
Similarity:47/134 - (35%) Gaps:32/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QFIEPNEDEESSSYSLRAAQDIVDSGNPPTKPQVPVAHAITTPLQNNINRKLNGFLSLRTPLIGG 102
            ::::.:::.|.:|..|.......:..|....|..|.|.....|.:.|          |..|.|..
 Worm   158 EWVQGSDEAEKTSEQLLNVMKSSEKRNSVQIPATPPAVKGKAPYKRN----------LTLPAIQT 212

  Fly   103 SGAS--QTKPQIISSVG-----------------NPGDGTTKDSANKSISMTDMYLDS---TDPS 145
            |..|  ..:|.::.|.|                 :|...::.:|:|.||:......||   ..|.
 Worm   213 SYLSVPDEEPGLVQSAGGNSNFSPKFWGGSPSPRSPRSFSSANSSNISINSPAAPNDSLRALHPR 277

  Fly   146 ENVG 149
            |.:|
 Worm   278 EAIG 281

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 1/3 (33%)
C2B_Synaptotagmin-7 277..414 CDD:176050