DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and SYT2

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_016855798.1 Gene:SYT2 / 127833 HGNCID:11510 Length:479 Species:Homo sapiens


Alignment Length:274 Identity:133/274 - (48%)
Similarity:191/274 - (69%) Gaps:6/274 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 ENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNP 210
            ||:|::.|||:||||...|.:.|||..||||.|:.|||||||:|.||||||.:.|||:.|:||||
Human   198 ENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNP 262

  Fly   211 RWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAK- 274
            .:||||.|: .|.|:|..:.|.:.::|:||||:.|.||||.:|:..||.......|:.|:...| 
Human   263 AFNETFTFK-VPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKE 326

  Fly   275 --DKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTC 337
              :|.|::.:||.|.|:...||:.:::|:|||..|:.|.||||||:.|....||::|:||.:...
Human   327 EPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKK 391

  Fly   338 TLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISK 402
            ||||.|||||||.:|:|:|::..:.|.|:|:|.:|:||.||:|.: |.|.:| :|.:||.||::.
Human   392 TLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFV-GSNATG-TELRHWSDMLAN 454

  Fly   403 PRQTVVQWHRLKPE 416
            ||:.:.|||.||||
Human   455 PRRPIAQWHSLKPE 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 64/123 (52%)
C2B_Synaptotagmin-7 277..414 CDD:176050 62/136 (46%)
SYT2XP_016855798.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.