DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and PLA2G4B

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001108105.1 Gene:PLA2G4B / 100137049 HGNCID:9036 Length:781 Species:Homo sapiens


Alignment Length:231 Identity:64/231 - (27%)
Similarity:100/231 - (43%) Gaps:61/231 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQS 228
            |.::|||...||:|||...||.||.:.|.....|||:|:..:.:.:|.||::|:|.   |.:...
Human    12 LTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVWNQSFHFR---IHRQLK 73

  Fly   229 RVLHLHVFDYDRFSRDDSIGEVFLPLCQVDF------AG---KQSFWKALKPPAKDKCGEL---- 280
            .|:.|.|||.|..:.||       |:..|.|      ||   ::||  :|.|..:   |.|    
Human    74 NVMELKVFDQDLVTGDD-------PVLSVLFDAGTLRAGEFRRESF--SLSPQGE---GRLEVEF 126

  Fly   281 -LSSLC----YHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIF---TC 337
             |.||.    :..||.:|.     ||.|....:..:         :.||::..:.:..:.   :|
Human   127 RLQSLADRGEWLVSNGVLV-----ARELSCLHVQLE---------ETGDQKSSEHRVQLVVPGSC 177

  Fly   338 TLNP----VFNESFSFNVP--WEKIRECSLDVMVMD 367
            . .|    |...:|.|:.|  ||:    .|.:.:.|
Human   178 E-GPQEASVGTGTFRFHCPACWEQ----ELSIRLQD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 40/115 (35%)
C2B_Synaptotagmin-7 277..414 CDD:176050 23/109 (21%)
PLA2G4BNP_001108105.1 C2_cPLA2 11..130 CDD:176001 44/132 (33%)
cPLA2_Grp-IVB-IVD-IVE-IVF 243..768 CDD:132840
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.