DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and syt17

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001096478.1 Gene:syt17 / 100125097 XenbaseID:XB-GENE-949409 Length:474 Species:Xenopus tropicalis


Alignment Length:415 Identity:138/415 - (33%)
Similarity:218/415 - (52%) Gaps:65/415 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NEDEESSSYSLRAAQDIVDSGNPPTKPQVPVAHAITTPLQN-----------NINRKLNGFLSLR 96
            :||:|..|.:        .:..||..||      .|:|.:.           ::.|:::...|.|
 Frog    66 SEDKEGDSDN--------TTSEPPATPQ------DTSPDRRRSSSDTSRSTYSLTRRISSLESRR 116

  Fly    97 --TPLI-------GGSGASQ--TKPQIISSVGNPGDGTTK--------DSANKSI-SMTDMYLDS 141
              :|||       |..||.:  .:|.::.....|.|...|        ||:|..: |:||   |.
 Frog   117 PSSPLIDIKPIEFGALGAKKEIVQPTVLRKSYTPEDYFRKFEPRLYSLDSSNDDVDSLTD---DE 178

  Fly   142 TDPSENVGQIHFSLEYDFQNTTLILKVLQGKELP--------AKDLSGTSDPYVRVTLLPDKKHR 198
            ......:|.:|||.:||..:..|.::|::.::||        .:|:: .|:|||::.||||:|:.
 Frog   179 ILTKYQLGMLHFSTQYDLLHNYLNVRVIEARDLPPPISYDGSRQDMA-HSNPYVKICLLPDQKNS 242

  Fly   199 LETKIKRRTLNPRWNETFYFEGFPIQKL--QSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAG 261
            .:|.:||:|.||.:.|.:.||   ||.|  |.|.|.|.:.|:|:|||...||:|.:||.:||...
 Frog   243 KQTGVKRKTQNPVFEERYTFE---IQFLEAQRRTLLLTIVDFDKFSRHCVIGKVAMPLNEVDLVK 304

  Fly   262 KQSFWKALKPPAKD--KCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGD 324
            ...:|||:.|.:::  :.||||.||.|.||...|.:.:|:|:.|...|::..|||:||:.|..|.
 Frog   305 GGHWWKAIIPSSQNEVELGELLLSLNYLPSAGRLNVDIIRAKQLLQTDMSQGSDPFVKIQLVHGL 369

  Fly   325 KRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSG 389
            |..:.:||.....|::|.:||||||.||.|::...||...|...:....|:.||||:: |:..||
 Frog   370 KLAKTKKTSCMRGTIDPFYNESFSFKVPQEELENVSLVFTVYGHNMKTSNDFIGRIVI-GQYASG 433

  Fly   390 ASETKHWQDMISKPRQTVVQWHRLK 414
            :.|:.||:.|::..|..|.|||.|:
 Frog   434 SPESNHWRRMLNSNRTAVEQWHSLR 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 51/133 (38%)
C2B_Synaptotagmin-7 277..414 CDD:176050 55/136 (40%)
syt17NP_001096478.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..112 11/59 (19%)
C2A_Synaptotagmin-15-17 186..314 CDD:176036 51/131 (39%)
C2B_Synaptotagmin-17 323..457 CDD:176055 55/134 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.