DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP102A and chin-1

DIOPT Version :9

Sequence 1:NP_001245416.1 Gene:RhoGAP102A / 43781 FlyBaseID:FBgn0259216 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_497323.3 Gene:chin-1 / 175268 WormBaseID:WBGene00015267 Length:421 Species:Caenorhabditis elegans


Alignment Length:190 Identity:55/190 - (28%)
Similarity:89/190 - (46%) Gaps:19/190 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   874 VPIFVNNCIDYLEDNGLQQVGLFRVSTSKKRVKQLREEFDKDIYFGISVDTCPHDVATLLKEFLR 938
            :|..|..||..:|..||...|::|||.|...:::|:::||.:.|..::.....|.|..|||.:.|
 Worm   247 LPPIVPLCIGEVESRGLDVEGIYRVSGSYDHMEKLKQQFDSNQYVDLATVCDIHTVCGLLKLYFR 311

  Fly   939 DLPEPLLCNTLYLTFLKTQRIRNRRLQLEAISHLIRLLPIPHRD----TLYVLLVFLAKVAAHSD 999
            .||:.|:..:::...|...:..|:|...|. ...||.:.:...|    ||..:|..|.|||.|| 
 Worm   312 LLPQQLIPFSVHKQLLVAYQETNQRSTHER-ERQIRKVMMELSDANIITLGAVLAHLKKVADHS- 374

  Fly  1000 DIWSTEGCCLTLGNKMDSYNLATVFAPNILRSTHLTFSRDKEQENMIDAINVVRTMINHY 1059
                       ..|||...||||:|:|.:..|..:....:.:..:.:  ||..|.:..|:
 Worm   375 -----------AKNKMTVENLATIFSPTLFCSGSIPAMPNHQLLHFL--INNPRVVPKHH 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP102ANP_001245416.1 RhoGAP 874..1069 CDD:295372 55/190 (29%)
chin-1NP_497323.3 SH2_a2chimerin_b2chimerin 43..130 CDD:198215
C1_1 172..224 CDD:278556
RhoGAP 248..413 CDD:238090 52/179 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.