Sequence 1: | NP_001245416.1 | Gene: | RhoGAP102A / 43781 | FlyBaseID: | FBgn0259216 | Length: | 1256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006498620.2 | Gene: | Chn1 / 108699 | MGIID: | 1915674 | Length: | 541 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 57/205 - (27%) |
---|---|---|---|
Similarity: | 93/205 - (45%) | Gaps: | 43/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 875 PIFVNNCIDYLEDNGLQQVGLFRVSTSKKRVKQLREEFDKD---------IYFGISVDTCPHDVA 930
Fly 931 TLLKEFLRDLPEPLLCNTLYLTFLKTQRIRNRRLQLEAISHLIRLLPIPHRDTLYVLLVFLAKVA 995
Fly 996 AHSDDIWSTEGCCLTLGNKMDSYNLATVFAPNILRSTHLTFSRDKEQENMIDAIN-------VVR 1053
Fly 1054 TMINHYEEIF 1063 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP102A | NP_001245416.1 | RhoGAP | 874..1069 | CDD:295372 | 57/205 (28%) |
Chn1 | XP_006498620.2 | SH2_a2chimerin_b2chimerin | 150..236 | CDD:198215 | |
C1_1 | 291..337 | CDD:365894 | |||
RhoGAP_chimaerin | 348..541 | CDD:239837 | 56/203 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
3 | 2.870 |