DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP102A and Chn1

DIOPT Version :9

Sequence 1:NP_001245416.1 Gene:RhoGAP102A / 43781 FlyBaseID:FBgn0259216 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_006498620.2 Gene:Chn1 / 108699 MGIID:1915674 Length:541 Species:Mus musculus


Alignment Length:205 Identity:57/205 - (27%)
Similarity:93/205 - (45%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   875 PIFVNNCIDYLEDNGLQQVGLFRVSTSKKRVKQLREEFDKD---------IYFGISVDTCPHDVA 930
            |:.|:.||..:|..||...||:|||.....::.::..||:|         :|..|::      :.
Mouse   364 PMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINI------IT 422

  Fly   931 TLLKEFLRDLPEPLLCNTLYLTFLKTQRIRNRRLQLEAISHLIRLLPIPHRDTLYVLLVFLAKVA 995
            ..||.:.||||.||:....|..|:::.:|.:...|||.:...:|.||..|.:||..|:..|.:|.
Mouse   423 GALKLYFRDLPIPLITYDAYPKFIESAKIMDPDEQLETLHEALRSLPPAHCETLRYLMAHLKRVT 487

  Fly   996 AHSDDIWSTEGCCLTLGNKMDSYNLATVFAPNILRSTHLTFSRDKEQENMIDAIN-------VVR 1053
            .|..:            |.|.:.||..||.|.::||..|         :.:.|:|       ||.
Mouse   488 LHEKE------------NLMSAENLGIVFGPTLMRSPEL---------DPMAALNDIRYQRLVVE 531

  Fly  1054 TMINHYEEIF 1063
            .:|.:.:.:|
Mouse   532 LLIKNEDILF 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP102ANP_001245416.1 RhoGAP 874..1069 CDD:295372 57/205 (28%)
Chn1XP_006498620.2 SH2_a2chimerin_b2chimerin 150..236 CDD:198215
C1_1 291..337 CDD:365894
RhoGAP_chimaerin 348..541 CDD:239837 56/203 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.