DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1674 and SYNPO2L

DIOPT Version :9

Sequence 1:NP_001245414.1 Gene:CG1674 / 43780 FlyBaseID:FBgn0039897 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_001107605.1 Gene:SYNPO2L / 79933 HGNCID:23532 Length:977 Species:Homo sapiens


Alignment Length:361 Identity:80/361 - (22%)
Similarity:133/361 - (36%) Gaps:110/361 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 PTLHPTVED----------QVEL-----------------ARRISHSLSDISNQTSKGQSMYVNR 308
            |..||..||          |.:|                 .|.|:..|:...|..|||..|:..|
Human   237 PVPHPVAEDLTTTYTQKAKQAKLQRAESLQEKSIKEAKTKCRTIASLLTAAPNPHSKGVLMFKKR 301

  Fly   309 KKRSDKW--VHEG-----GSQGNDAINPFKENSETKSTMEVAKLEKIPLKLIMNPNGKVRDYNS- 365
            ::|:.|:  |..|     |::..|.:.|..|:...:.....|       :.:.|.:    |::| 
Human   302 RQRAKKYTLVSFGAAAGTGAEEEDGVPPTSESELDEEAFSDA-------RSLTNQS----DWDSP 355

  Fly   366 LKDLINVEAGLLSPDNCAELITALQLHQ--GRGAELFAKRRRKADNWVVDESHSGTQ----YHPS 424
            ..|:....||..:.:.....:.. ||.:  |||.:||.::|::||        |.||    ..|:
Human   356 YLDMELARAGSRASEGQGSGLGG-QLSEVSGRGVQLFEQQRQRAD--------SSTQELARVEPA 411

  Fly   425 GIPDFQQYQQRP----------VLSPNILPA-------YSDAGKHRVQLNIHQNQLIEKYSKPGL 472
            .:.:.:..|..|          ||.|:.|||       :...|..........|:....:: |||
Human   412 AMLNGEGLQSPPRAQSAPPEAAVLPPSPLPAPVASPRPFQPGGGAPTPAPSIFNRSARPFT-PGL 475

  Fly   473 QVVQ-----------SPWKAALQTGSASSAFLEDTKSFSPPAL-----TPIPSSQAGSKDWTDAN 521
            |..:           :|.:|....|..|.|        .||.|     ||:||..:|    ..::
Human   476 QGQRPTTTSVIFRPLAPKRANDSLGGLSPA--------PPPFLSSQGPTPLPSFTSG----VPSH 528

  Fly   522 EPMPHGSSRRNTNAVASSPRSVIVPSNPQRDLAYTP 557
            .|:....|...::...::..|:.:|: |.|.:  ||
Human   529 APVSGSPSTPRSSGPVTATSSLYIPA-PSRPV--TP 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1674NP_001245414.1 None
SYNPO2LNP_001107605.1 PDZ_signaling 6..85 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..226
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..352 6/45 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..677 51/223 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..802
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 922..950
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24217
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.