DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1674 and Synpo2l

DIOPT Version :9

Sequence 1:NP_001245414.1 Gene:CG1674 / 43780 FlyBaseID:FBgn0039897 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_001292067.1 Gene:Synpo2l / 305675 RGDID:1565434 Length:978 Species:Rattus norvegicus


Alignment Length:230 Identity:55/230 - (23%)
Similarity:88/230 - (38%) Gaps:66/230 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 GLLSPDNCAELITALQLHQGRGAELFAKRRRKADNWVVDESHSGTQYHPSGIPDFQQYQQRPVLS 439
            ||::.......|..|...||||.||||||:.:||.:|| |:..|:..:|...|      :.|..:
  Rat   737 GLVNGSTSMVGIPELPRLQGRGGELFAKRQSRADRYVV-EATPGSSLNPGLRP------RSPSPT 794

  Fly   440 PNILPAYSDAGKHRVQLNIHQNQLIEKY--------------------SKPGLQVV--------- 475
            |::.|::..:...|....|..|.|:..:                    .|.|::.:         
  Rat   795 PSLPPSWKYSPNIRAPPPIAYNPLLSPFFPQAARTLPNKAQSQGPRATPKQGIKALDFMRHQPYQ 859

  Fly   476 ---------QSPWKAALQTGSASSAFLEDTKSFSPPA----LTPIPSSQAGSKDWTDANEPMPHG 527
                     :.|...|..:|...:|.:::.:.||.||    ..|:..:....:..|..:||:...
  Rat   860 LKTAMFCFDEGPSTPASTSGPPKTARVQEIRRFSTPAPQPTAEPLAPTVLAPRAATTLDEPIWRA 924

  Fly   528 SSRRNTNAVASSPRSVIVPSNPQ-----RDLAYTP 557
            .       :||||    || ||.     |..|.||
  Rat   925 E-------LASSP----VP-NPDHLESLRSFAATP 947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1674NP_001245414.1 None
Synpo2lNP_001292067.1 PDZ_signaling 6..85 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24217
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.