Sequence 1: | NP_001245414.1 | Gene: | CG1674 / 43780 | FlyBaseID: | FBgn0039897 | Length: | 905 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001292067.1 | Gene: | Synpo2l / 305675 | RGDID: | 1565434 | Length: | 978 | Species: | Rattus norvegicus |
Alignment Length: | 230 | Identity: | 55/230 - (23%) |
---|---|---|---|
Similarity: | 88/230 - (38%) | Gaps: | 66/230 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 375 GLLSPDNCAELITALQLHQGRGAELFAKRRRKADNWVVDESHSGTQYHPSGIPDFQQYQQRPVLS 439
Fly 440 PNILPAYSDAGKHRVQLNIHQNQLIEKY--------------------SKPGLQVV--------- 475
Fly 476 ---------QSPWKAALQTGSASSAFLEDTKSFSPPA----LTPIPSSQAGSKDWTDANEPMPHG 527
Fly 528 SSRRNTNAVASSPRSVIVPSNPQ-----RDLAYTP 557 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1674 | NP_001245414.1 | None | |||
Synpo2l | NP_001292067.1 | PDZ_signaling | 6..85 | CDD:238492 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166341796 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24217 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |