DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-h and yellow-f

DIOPT Version :9

Sequence 1:NP_651912.3 Gene:yellow-h / 43779 FlyBaseID:FBgn0039896 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster


Alignment Length:408 Identity:138/408 - (33%)
Similarity:218/408 - (53%) Gaps:31/408 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VYEWKYLDFLY----------------STFVQRQQ---SILNGDFVPKNNLPLGIDVHNNRLFVT 101
            |::||.|||..                |.|...::   |..:|.|:..||:|.|:.....|||||
  Fly    29 VFKWKQLDFYNRGDGYKDLWNRICIPDSHFYNSRKCLGSSSSGSFIQYNNVPQGVTHFRGRLFVT 93

  Fly   102 TPRWKNGVPASLGTLPFPPK--ESSPAIKPYPNWEAHGNPNNPDCSKLMSVYRTAVDRCDRIWLI 164
            .||.:.|:|::|..:.....  ..||.::.|||...  |..|.....|:|||||:||.|.|:|.:
  Fly    94 VPRRQPGIPSTLNYIDLAKDGWSQSPHLRAYPNLAV--NQYNASEQNLVSVYRTSVDVCGRLWFV 156

  Fly   165 DSGIVNATINLNQICPPKIVVYDLKSDELIVRYNLEASHVKQDSLHSNIVVDIG-EDCDDAHAIV 228
            |:|::....|..||..|.|.|.||.:|.|:.|:.:..|.|:.....::|.:|:| ..|:||:|.:
  Fly   157 DTGMLEFPNNRQQIRHPSIWVIDLANDRLLKRFEIPQSIVEIGRGLASITIDVGARRCNDAYAYI 221

  Fly   229 SDVWRFGLLVYSLSKNRSWRVTNYNFYPDPFASDFNVYGLNFQWLDGVFGMSIYYNKKIMERVLY 293
            .|:....|.||.|..:|.|...:..|..||.:.:.|:.|..|:|.||:|..::...|....|.::
  Fly   222 PDLVNRRLHVYHLRSDRIWSFEHSFFNFDPLSDNLNIGGQTFRWDDGIFSATLGSYKPDGSRDVF 286

  Fly   294 FHPMASFKEFMVPMNILLNESVWQTNTQEYAKYFIPIGDRGYNSQSSTSGV-TRNGIMFFTQVHQ 357
            ||||||..||:|...:|..|  :.....::...|..:|.||.::||:.... .|.|::||.:|.:
  Fly   287 FHPMASTNEFVVSNRVLQQE--FNAARSDHGDDFHLLGTRGPSTQSTMHKYDPRTGVIFFAEVQK 349

  Fly   358 DDIGCWDTSKPYTRAHLGKFHNMENSNLIQFPNDLKVDKEKDQNVWLISNRLPIFLYSNLDYGEV 422
            ..:|||.||||::..:.|..::  ||:.:.:|:||.:|:|  ..:|::||.:|||:||.||..:.
  Fly   350 SGVGCWKTSKPFSTENHGSVYS--NSSEMIYPSDLTIDEE--GYIWVMSNSMPIFVYSKLDVEKY 410

  Fly   423 NFRILKANVNKIIRNSVC 440
            ||||.:.:.....|.:||
  Fly   411 NFRIWRQSTLLAKRGTVC 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-hNP_651912.3 MRJP 148..440 CDD:281074 103/293 (35%)
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 103/293 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449207
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.