DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-h and yellow-g2

DIOPT Version :9

Sequence 1:NP_651912.3 Gene:yellow-h / 43779 FlyBaseID:FBgn0039896 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster


Alignment Length:370 Identity:85/370 - (22%)
Similarity:145/370 - (39%) Gaps:70/370 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NGDFVPKNNLPLGIDVHNNRLFVTTPRWKNGVPASLGTLPFPPKESSPAIKPYPNWEAHGNPNNP 142
            :|.|:|||.:.....:..:.:::..||::.||||:|......|...|...||||.|:.....|  
  Fly    60 SGKFIPKNVIATRAQLIGDTIYLALPRYRKGVPATLVKTSIKPGTCSTTFKPYPCWDLQEEGN-- 122

  Fly   143 DCSKLMSVYRTAVDRCDRIWLIDSGIVNATINLNQICPPKIVVYDLKSDELIVRYNLEASHVKQD 207
             |..|.||....||:.:.:|::|:||||......:.||||:|...:|:.:::...:||.. ...:
  Fly   123 -CKALQSVVDLVVDQNEVLWVLDTGIVNTLETPVRKCPPKVVAMSVKTGKVLKTVSLEGL-TSSN 185

  Fly   208 SLHSNIVVDIGEDCDDAHAIVSDVWRFGLLVYSLSKNRSWRVTNYNFYPDPFASDFNVYGLNFQW 272
            |....:|||...| ......|||.....::||:|..:|.:||.    .|....:           
  Fly   186 SRLQYLVVDYAPD-GGCFVYVSDAANRAIIVYNLQADRGFRVV----LPKAVTA----------- 234

  Fly   273 LDGVFGMSIYY----NKKIMERVLYFHPMASFKEFMVPMNILLNESVWQTNTQEYAKYFIPIG-- 331
              |.....:.|    .:......|||..:::.|.|.:              ..||.:..:..|  
  Fly   235 --GCRSRDVLYIALIRRDCGSTELYFTYLSTNKLFSL--------------KSEYLRSGVADGRI 283

  Fly   332 -DRGYN-SQSSTSGVTRNGIMFFTQVHQDDIGCWDTSKPYTRAHLGKFHNMENSNLIQFPNDLKV 394
             |.|.. |:....|......:||......::..|||:..:..|:....:                
  Fly   284 LDLGKKPSRMVIIGTDNGSAIFFRNEGDAEVYRWDTNSTFVEANFKPVY---------------- 332

  Fly   395 DKEKDQNVWLISNRLPIFLYSNLDYGEVNFRILKANVNKIIRNSV 439
               :.|...|:::.:|       ||.....|:|::|....::|.|
  Fly   333 ---RSQTCQLVTHAVP-------DYKRNTMRVLQSNFPDYMQNRV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-hNP_651912.3 MRJP 148..440 CDD:281074 63/300 (21%)
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 63/300 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.