DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-h and yellow-d

DIOPT Version :9

Sequence 1:NP_651912.3 Gene:yellow-h / 43779 FlyBaseID:FBgn0039896 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_523820.2 Gene:yellow-d / 37703 FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster


Alignment Length:400 Identity:120/400 - (30%)
Similarity:202/400 - (50%) Gaps:38/400 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNN-------RLFVTTPRWKNGVP 110
            :|.:.:|..|:|.:.|...|:.:...|:.||:|..|  |||...       |||.|.||:..|:|
  Fly    34 VETLTQWGQLEFGFPTAQDRENAQAAGNLVPENGTP--IDVQPQYMANGQIRLFTTIPRFVTGIP 96

  Fly   111 ASLGTLPFPPKESSPAIKPYPNWEAHGNPNNPDCSKLMSVYRTAVDRCDRIWLIDSGIVNATINL 175
            .:|.|:......:.|.::||||:..| |.|..||.::.|.:|.|:..|:::|:||||::..|   
  Fly    97 YTLATVSATQGRNGPLLQPYPNYSWH-NANGEDCDRITSAFRVAITECNQMWVIDSGVIGTT--- 157

  Fly   176 NQICPPKIVVYDLKSDELIVRYNL-EASHVKQDSLH--SNIVVDIGED------CDDAHAIVSDV 231
             |:|||:::.:.|.:|.|:.|:.. ..:::...||.  .|::|   :|      |......|:||
  Fly   158 -QLCPPQLLQFALATDRLLHRFRFPNDTYIPSGSLFITPNVLV---QDPPPRGTCSRTMIYVADV 218

  Fly   232 WRFGLLVYSLSKNRSWRVTNYNFYPDPFASDFNVYGLNFQWLDGVFGMSIYYNKKIMERVLYFHP 296
            ...||:||......|||..|...||||......:.|.:|..:||:|.::   |.|   |.|||||
  Fly   219 SYHGLVVYDHQAQTSWRAENRFMYPDPDYGKHTIAGESFYLMDGMFALN---NDK---RNLYFHP 277

  Fly   297 MASFKEFMVPMNILLNESVWQTNTQEYAKYFIPIGDRGYNSQSSTSGVTRNGIMFFTQVHQDDIG 361
            :||..|:.||::.|..:..|....:...:.|..:|.|  .|:.:.|.:.....::....:...:.
  Fly   278 LASASEYSVPLSALNRQQNWANGPEALPEEFRLLGRR--RSECAASAIDGRNNVYCVTFNPVKLF 340

  Fly   362 CWDTSKPYTRAHLGKFHNMENSNLIQFPNDLKV--DKEKDQNVWLISNRLPIFLYSNLDYGEVNF 424
            .|:.:.||...:.|..  ...|:.:||.:.:||  ::|..:.:|::|||........|:..||||
  Fly   341 VWNVNSPYNSRNFGNL--PAKSDDLQFVSGMKVLRNREGQEELWMLSNRYQKIAAGTLNSKEVNF 403

  Fly   425 RILKANVNKI 434
            |||:..::.:
  Fly   404 RILRRKLDDV 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-hNP_651912.3 MRJP 148..440 CDD:281074 86/297 (29%)
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 86/296 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449218
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D202564at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.