DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment yellow-h and Rgn

DIOPT Version :9

Sequence 1:	NP_651912.3	Gene:	yellow-h / 43779	FlyBaseID:	FBgn0039896	Length:	463	Species:	Drosophila melanogaster
Sequence 2:	NP_113734.1	Gene:	Rgn / 25106	RGDID:	3560	Length:	299	Species:	Rattus norvegicus

Alignment Length:	47	Identity:	13/47 - (27%)
Similarity:	22/47 - (46%)	Gaps:	3/47 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 VFLSKTLNGNLSVQPVFQTLDGYEYTSQSFSQNLQSE--SQLEIVYE 58
            |.:|..|:.:|. ..:|..:|...||..:|..:|.:.  |....||:
  Rat   150 VDISNGLDWSLD-HKIFYYIDSLSYTVDAFDYDLPTGQISNRRTVYK 195

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
yellow-h	NP_651912.3	MRJP	148..440	CDD:281074
Rgn	NP_113734.1	SGL	16..264	CDD:285626	13/47 (28%)
		NHL	166..>237	CDD:302697	8/30 (27%)
		WD40 repeat	203..239	CDD:293791
		NHL repeat	203..237	CDD:271320
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG3386
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900