DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31999 and Fbln7

DIOPT Version :9

Sequence 1:NP_001284712.1 Gene:CG31999 / 43777 FlyBaseID:FBgn0051999 Length:917 Species:Drosophila melanogaster
Sequence 2:NP_077199.2 Gene:Fbln7 / 70370 MGIID:1917620 Length:440 Species:Mus musculus


Alignment Length:511 Identity:120/511 - (23%)
Similarity:184/511 - (36%) Gaps:160/511 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 NTRGSFRCYRKISTMLTTRTTSTTVPPLSLENARRSFTSRYPYPLAVHPEYSQNNDSISTNRRVD 504
            |.:......:.....:|......:.|.|......:.|.|:|   |..|..|            ..
Mouse    57 NMKSRLAALQNTVNKMTPDAPPVSCPALEAPPDGKKFGSKY---LVDHEVY------------FT 106

  Fly   505 CSPGF---------------YRNTLGACIDTNECMEQNPCGNHERCINTNGHFRCESLLQCSPGY 554
            |:|||               :......|.|.:||..| ||.|...|:....|:||    .|.|| 
Mouse   107 CNPGFQLVGPSSVVCLANGSWTGEQPRCRDISECSSQ-PCHNGGTCVEGINHYRC----ICPPG- 165

  Fly   555 KSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVCSCPIGHELKRSIGGASTCVDTNECALEQ 619
                                ..|.|  |:::.   ..:.|.|.|     .|.........||..:
Mouse   166 --------------------KTGNR--CQHQT---QAAAPDGGE-----AGDPAFSRAPRCAQVE 200

  Fly   620 RVCPLNAQCFNTIGAYYCECKAGFQKKSDGNNSTQCFDIDECQVIPGLCQQKCLNFWGGYRCTCN 684
            |             ..:|.|:|||...|.                           .||:     
Mouse   201 R-------------EQHCSCEAGFHLSST---------------------------TGGH----- 220

  Fly   685 SGYQLGPDNRTCNDINECEVHKDY---KLCMGLCINTPGSYQCSCPRGYILAADMNTCRDVDECA 746
                     ..|.|:||||::...   :|||..|:||||||:|:||.||.:.||..:|.||||||
Mouse   221 ---------SVCQDVNECEIYGQKGRPRLCMHACVNTPGSYRCTCPSGYRILADGKSCEDVDECA 276

  Fly   747 TDSINQVCTGRNDICTNIRGSYKCTTVNCPLG------YSIDPEQKNRCRQNLNFCEGEECYTQP 805
              ....:|. |...|.|..|.::|....||.|      ....|.|   |.:|....:...|...|
Mouse   277 --GPQHMCP-RGTTCINTGGGFQCVNPECPEGSGNISYVKTSPFQ---CERNPCPMDSRPCRHLP 335

  Fly   806 SAFTYNFITFVSKLMIPPDGRTIFTLR--------GPLWYDNIEFDLKIVRIQATTNIQKATDGS 862
            ...::::::..|||..|   .|:|.:.        ||   :::.|.:          :...:.|.
Mouse   336 KTISFHYLSLPSKLKTP---ITLFRMATASIPGHPGP---NSLRFGI----------VGGNSRGH 384

  Fly   863 FDTLQNNNQV-NVILKKSLEGPQDIELELSMTVYTNGMPRGKSVAKLFLFVSQHTF 917
            |...:::.|. .:||.::|||||.:|:::.|:.|.....:...|:|:.:|||::.|
Mouse   385 FVMQRSDRQTGELILTQTLEGPQTLEVDVDMSEYLERSFQANHVSKVTIFVSRYDF 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31999NP_001284712.1 vWFA <189..227 CDD:294047
EGF_CA 251..293 CDD:238011
EGF_CA 328..>363 CDD:214542
EGF_CA 519..564 CDD:214542 14/44 (32%)
EGF_CA 565..601 CDD:238011 6/35 (17%)
EGF_CA 611..651 CDD:284955 9/39 (23%)
vWFA <655..695 CDD:294047 2/39 (5%)
cEGF 678..701 CDD:289433 3/22 (14%)
EGF_CA 698..>730 CDD:214542 18/34 (53%)
cEGF 721..744 CDD:289433 12/22 (55%)
Fbln7NP_077199.2 CCP 81..135 CDD:153056 12/68 (18%)
EGF_CA 136..172 CDD:238011 16/63 (25%)
vWFA <221..268 CDD:294047 23/46 (50%)
cEGF 251..274 CDD:289433 12/22 (55%)
EGF_CA 271..308 CDD:284955 15/39 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002570
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.