DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31999 and npnta

DIOPT Version :9

Sequence 1:NP_001284712.1 Gene:CG31999 / 43777 FlyBaseID:FBgn0051999 Length:917 Species:Drosophila melanogaster
Sequence 2:XP_009292491.1 Gene:npnta / 563273 ZFINID:ZDB-GENE-090312-201 Length:636 Species:Danio rerio


Alignment Length:391 Identity:114/391 - (29%)
Similarity:148/391 - (37%) Gaps:116/391 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 EYSQNNDSISTNRRVDCSPGFYRNTLGAC---------IDTNECMEQNPCGN---HERCINTNGH 541
            :.|.:|.......|:||..|:.|.:.|.|         :....|..|..|.:   |..|:..|  
Zfish    27 QMSSSNGLCRYGGRIDCCWGWTRVSWGQCQPLYVLTRRVIGIRCQPQALCQHGCKHGECVGPN-- 89

  Fly   542 FRCESLLQCSPGYKSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVCSCPIGHEL------- 599
             :|    :|.|||    .||:|           |..||        ||| |.|:.|..       
Zfish    90 -KC----KCHPGY----TGKTC-----------NQDER--------GFV-SPPLWHSHAPVFVPM 125

  Fly   600 -KRSIGGASTCVDTNECALEQRVCPLNAQCFNTIGAYYCECKAGFQKKSDGNNSTQCFDIDECQV 663
             .:.|...|.  |.|||.|:.|.|  ..:|.||.|::.|.|..||....||:    |.:...|.:
Zfish   126 DHQPIAAPSE--DLNECGLKPRPC--KHRCMNTFGSFKCYCLNGFMLLPDGS----CANARTCSM 182

  Fly   664 IPGLCQQKCLNFWGGYRCTCNS-GYQLGPDNRTCNDINECEVHKDYKLCMGL--------CINTP 719
              ..||..|....|..||.|.| |.||.||.|||.|::||        ..||        ||||.
Zfish   183 --ANCQYGCEVMKGEVRCQCPSPGLQLAPDGRTCVDVDEC--------AAGLAVCPRFRKCINTF 237

  Fly   720 GSYQCSCPRGYIL--AADMNTCRDVDECATDSINQVCTGRNDICTNIRGSYKCTTVNCP-----L 777
            |||.|.|..|:.|  ......|.||:||   |:.|...|....|.|..|||||   .|.     :
Zfish   238 GSYICKCHDGFDLQYVNGKYQCTDVNEC---SLGQHQCGPYATCYNTPGSYKC---KCKEDYRGV 296

  Fly   778 GYS--------IDPEQKNRCRQNLNFCEGEECYTQPSAFTYNFITFVSKLMIPPDGRTIFTLRGP 834
            ||.        |||.:..:...:.|..:|.                 :|:......||..|:|.|
Zfish   297 GYDCKPIPKVVIDPPRPGKTTPSSNNNKGG-----------------NKIPGSDQKRTTTTVRPP 344

  Fly   835 L 835
            :
Zfish   345 V 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31999NP_001284712.1 vWFA <189..227 CDD:294047
EGF_CA 251..293 CDD:238011
EGF_CA 328..>363 CDD:214542
EGF_CA 519..564 CDD:214542 13/47 (28%)
EGF_CA 565..601 CDD:238011 9/43 (21%)
EGF_CA 611..651 CDD:284955 17/39 (44%)
vWFA <655..695 CDD:294047 15/40 (38%)
cEGF 678..701 CDD:289433 13/23 (57%)
EGF_CA 698..>730 CDD:214542 14/39 (36%)
cEGF 721..744 CDD:289433 9/24 (38%)
npntaXP_009292491.1 EGF_CA 136..168 CDD:238011 15/33 (45%)
cEGF 197..219 CDD:289433 13/21 (62%)
EGF_CA 216..>248 CDD:284955 14/39 (36%)
EGF_3 265..300 CDD:289699 14/40 (35%)
MAM 487..629 CDD:279023
MAM 487..627 CDD:99706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11922
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.