DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31999 and egfl6

DIOPT Version :9

Sequence 1:NP_001284712.1 Gene:CG31999 / 43777 FlyBaseID:FBgn0051999 Length:917 Species:Drosophila melanogaster
Sequence 2:XP_017213153.1 Gene:egfl6 / 436730 ZFINID:ZDB-GENE-040718-157 Length:539 Species:Danio rerio


Alignment Length:372 Identity:92/372 - (24%)
Similarity:125/372 - (33%) Gaps:147/372 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 KDRKCVKIQS----CDKGFSLHNGTCSDIDECSH----KSLNNCHVNSNQECVN--TVGSYSCNC 359
            :.|:.:.:.|    |..|..|         ||.:    .:...|....:..|.:  .||...|.|
Zfish    24 RQRRQISVMSGLGVCRYGSRL---------ECCYGWKKNTKGQCEAQCDLGCKHGECVGPNKCKC 79

  Fly   360 LPGFNLDATLNKC-VDINECSINNHNCLPTQRCDNTIGSYICTRLQSCGTGYTLNAETGNCDDDD 423
            .||:    |...| .|:|||.:....|  ..||.||.|||:|    .|..||.|..: |:|.:..
Zfish    80 FPGY----TGKTCSQDLNECGLKPRPC--EHRCMNTFGSYMC----YCLNGYMLMPD-GSCANSR 133

  Fly   424 ECTLSTHNCPSNYDCHNTRGSFRCYRKISTMLTTRTTSTTVPPLSLENARRSFTSRYPYPLAVHP 488
            .|:|:  :|  .|.|...:...||                                         
Zfish   134 TCSLA--HC--QYGCEEVQSEVRC----------------------------------------- 153

  Fly   489 EYSQNNDSISTNRRVDCSPGFYRNTLGACIDTNECMEQNPCGNHERCINTNGHFRCESLLQCSPG 553
                                                                       |..|||
Zfish   154 -----------------------------------------------------------LCPSPG 159

  Fly   554 YKSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVCSCPIGHELKRSIGGASTCVDTNECALE 618
            .:...|||:|.|||||.||::.|...:.|.|..|.:.|.|..|::|| .|.|...|||.|||...
Zfish   160 LQLGSDGKTCEDIDECATGKNQCPFNRQCTNTFGSYYCKCQPGYDLK-YINGKYDCVDVNECTSN 223

  Fly   619 QRVCPLNAQCFNTIGAYYCECKAGFQKKSDGNNSTQCFDIDECQVIP 665
            ...|..:|:|.||:|:|.|:||.||:...        ||   |.|.|
Zfish   224 THKCSHHAECINTLGSYKCKCKQGFRGSG--------FD---CSVKP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31999NP_001284712.1 vWFA <189..227 CDD:294047
EGF_CA 251..293 CDD:238011
EGF_CA 328..>363 CDD:214542 9/40 (23%)
EGF_CA 519..564 CDD:214542 7/44 (16%)
EGF_CA 565..601 CDD:238011 15/35 (43%)
EGF_CA 611..651 CDD:284955 16/39 (41%)
vWFA <655..695 CDD:294047 5/11 (45%)
cEGF 678..701 CDD:289433
EGF_CA 698..>730 CDD:214542
cEGF 721..744 CDD:289433
egfl6XP_017213153.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11922
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.