DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31999 and adgrl4

DIOPT Version :9

Sequence 1:NP_001284712.1 Gene:CG31999 / 43777 FlyBaseID:FBgn0051999 Length:917 Species:Drosophila melanogaster
Sequence 2:NP_998532.2 Gene:adgrl4 / 406676 ZFINID:ZDB-GENE-040426-2689 Length:735 Species:Danio rerio


Alignment Length:254 Identity:65/254 - (25%)
Similarity:95/254 - (37%) Gaps:76/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   547 LLQCSPGYKSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVCSCPIGHELKRSIGGASTCVD 611
            ||..:..:.|.:|  .|..:|.|    .:|.....|.:     :|.|..|:    :..|.|.|.|
Zfish    11 LLLFAAWFSSLLD--PCRFLDIC----QSCHPNADCDD-----ICKCRTGY----TGNGISDCRD 60

  Fly   612 TNECALEQRVCPLNAQCFNTIGAYYCECKAGFQKKSDGNNSTQCFDIDECQVIPGLCQQKCLNFW 676
            .|||.....:|.|:|.|.|.:|.|||.|.:||.     :|.|:.|..:                 
Zfish    61 DNECETVPEICGLHANCTNYVGGYYCNCLSGFI-----SNGTEQFQTN----------------- 103

  Fly   677 GGYRCTCNSGYQLGPDNRTCNDINECEVHKDYKLC--MGLCINTPGSYQCSCPRGYILAAD---- 735
                           |..:||||||||  :|.| |  ...|.|..||:.|||.|||...|.    
Zfish   104 ---------------DGTSCNDINECE--EDRK-CGPNSKCHNNIGSFICSCLRGYTSPAGPWFM 150

  Fly   736 --------MNT---CRDVDECATDSINQVCTGRNDICTNIRGSYKCTTVNCPLGYSIDP 783
                    .|:   |....:|..:::|...    :..||:..|.:...:......::.|
Zfish   151 PNHGTDCIENSKIHCHQDHKCTKETVNSTL----ERMTNLSISERLKEIRYQTSAALSP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31999NP_001284712.1 vWFA <189..227 CDD:294047
EGF_CA 251..293 CDD:238011
EGF_CA 328..>363 CDD:214542
EGF_CA 519..564 CDD:214542 4/16 (25%)
EGF_CA 565..601 CDD:238011 7/35 (20%)
EGF_CA 611..651 CDD:284955 16/39 (41%)
vWFA <655..695 CDD:294047 2/39 (5%)
cEGF 678..701 CDD:289433 5/22 (23%)
EGF_CA 698..>730 CDD:214542 17/33 (52%)
cEGF 721..744 CDD:289433 10/37 (27%)
adgrl4NP_998532.2 EGF_CA 34..56 CDD:304395 6/30 (20%)
EGF_CA 60..93 CDD:238011 15/32 (47%)
EGF_CA 110..143 CDD:214542 19/35 (54%)
GAIN 188..386 CDD:293098 2/18 (11%)
GPS 416..457 CDD:280071
7tm_4 469..705 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.