DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31999 and Matn3

DIOPT Version :9

Sequence 1:NP_001284712.1 Gene:CG31999 / 43777 FlyBaseID:FBgn0051999 Length:917 Species:Drosophila melanogaster
Sequence 2:NP_001382499.1 Gene:Matn3 / 313954 RGDID:1305085 Length:481 Species:Rattus norvegicus


Alignment Length:264 Identity:74/264 - (28%)
Similarity:101/264 - (38%) Gaps:76/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   509 FYRNTLGACIDTNECMEQNPC-------GNHE---RCINT-NGHFRCESLLQCSPGYKSTVDGKS 562
            ||..|.|.....:...::..|       |.|:   .|::. :|...||    ||.||....|||:
  Rat   238 FYVETYGVIEKLSARFQETFCALDQCMLGTHQCQHVCVSDGDGRHHCE----CSQGYTLNADGKT 298

  Fly   563 CIDIDECDTGEHNCGERQICRN-RNGGFVCSCPIGHELKRSIGGASTCVDTNECALEQRVCPLNA 626
            |..||:|....|.|  .|||.| |||.:.|.|..|:.|.   ....||...::|||         
  Rat   299 CSAIDKCALNTHGC--EQICVNDRNGSYHCECYEGYTLN---ADRKTCAAQDKCAL--------- 349

  Fly   627 QCFNTIGAYYCECKAGFQKKSDGNNSTQCFDIDECQVIPGLCQQKCLNFW-GGYRCTCNSGYQLG 690
               .|.|                                  ||..|:|.. |.:.|.|..||.|.
  Rat   350 ---GTHG----------------------------------CQHICVNDGAGSHHCECFEGYTLN 377

  Fly   691 PDNRTCNDINECEV--HKDYKLCMGLCINTPG-SYQCSCPRGYILAADMNTCRDVDEC-ATDSIN 751
            .|.:||:..::|.:  |.    |..:|::... ||.|.|..||.|..|..||.|::|. :..||.
  Rat   378 ADKKTCSVRDKCALGTHG----CQHICVSDGAVSYHCDCFPGYTLNDDKKTCSDIEEVRSLISIE 438

  Fly   752 QVCT 755
            ..|:
  Rat   439 DACS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31999NP_001284712.1 vWFA <189..227 CDD:294047
EGF_CA 251..293 CDD:238011
EGF_CA 328..>363 CDD:214542
EGF_CA 519..564 CDD:214542 14/55 (25%)
EGF_CA 565..601 CDD:238011 16/36 (44%)
EGF_CA 611..651 CDD:284955 5/39 (13%)
vWFA <655..695 CDD:294047 11/40 (28%)
cEGF 678..701 CDD:289433 8/22 (36%)
EGF_CA 698..>730 CDD:214542 8/34 (24%)
cEGF 721..744 CDD:289433 11/22 (50%)
Matn3NP_001382499.1 vWFA 75..298 CDD:412136 17/63 (27%)
FXa_inhibition 305..341 CDD:405372 14/40 (35%)
FXa_inhibition 347..383 CDD:405372 16/81 (20%)
FXa_inhibition 389..425 CDD:405372 12/39 (31%)
Matrilin_ccoil 438..478 CDD:402147 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.