DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31999 and Vwa2

DIOPT Version :9

Sequence 1:	NP_001284712.1	Gene:	CG31999 / 43777	FlyBaseID:	FBgn0051999	Length:	917	Species:	Drosophila melanogaster
Sequence 2:	NP_766428.2	Gene:	Vwa2 / 240675	MGIID:	2684334	Length:	791	Species:	Mus musculus

Alignment Length:	48	Identity:	16/48 - (33%)
Similarity:	23/48 - (47%)	Gaps:	9/48 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   516 ACIDTNECMEQNPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKSC 563
            |.:..|.| :.:||.|...|:..||.:|||    |..|:    :|..|
Mouse   708 ARLPVNLC-KPSPCMNEGTCVLKNGSYRCE----CRGGW----EGPHC 746

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31999	NP_001284712.1	vWFA	<189..227	CDD:294047
		EGF_CA	251..293	CDD:238011
		EGF_CA	328..>363	CDD:214542
		EGF_CA	519..564	CDD:214542	15/45 (33%)
		EGF_CA	565..601	CDD:238011
		EGF_CA	611..651	CDD:284955
		vWFA	<655..695	CDD:294047
		cEGF	678..701	CDD:289433
		EGF_CA	698..>730	CDD:214542
		cEGF	721..744	CDD:289433
Vwa2	NP_766428.2	vWA_collagen	50..204	CDD:238749
		EGF	298..328	CDD:278437
		VWA	342..515	CDD:278519
		vWFA	530..687	CDD:294047
		EGF_CA	712..747	CDD:238011	15/44 (34%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	762..791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000