powered by:
Protein Alignment CG31999 and Vwa2
DIOPT Version :9
Sequence 1: | NP_001284712.1 |
Gene: | CG31999 / 43777 |
FlyBaseID: | FBgn0051999 |
Length: | 917 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_766428.2 |
Gene: | Vwa2 / 240675 |
MGIID: | 2684334 |
Length: | 791 |
Species: | Mus musculus |
Alignment Length: | 48 |
Identity: | 16/48 - (33%) |
Similarity: | 23/48 - (47%) |
Gaps: | 9/48 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 516 ACIDTNECMEQNPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKSC 563
|.:..|.| :.:||.|...|:..||.:||| |..|: :|..|
Mouse 708 ARLPVNLC-KPSPCMNEGTCVLKNGSYRCE----CRGGW----EGPHC 746
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.