DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31999 and Creld1

DIOPT Version :9

Sequence 1:NP_001284712.1 Gene:CG31999 / 43777 FlyBaseID:FBgn0051999 Length:917 Species:Drosophila melanogaster
Sequence 2:NP_598691.1 Gene:Creld1 / 171508 MGIID:2152539 Length:420 Species:Mus musculus


Alignment Length:277 Identity:79/277 - (28%)
Similarity:97/277 - (35%) Gaps:87/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 ESLLQCSPGYKSTVDGKSCIDIDECDTG-EHNCGERQICR---NRNGGFVCSCPIGHELKRSIGG 605
            :||..|.|   |...|.||:   .|..| |..||....|.   .|.|...|.|..|:       |
Mouse   137 DSLKLCCP---SGTFGPSCL---PCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGY-------G 188

  Fly   606 ASTCVDTNECAL---------EQRVC-----PLNAQCFNTIGAYYCECKAGFQKKSDGNNSTQCF 656
            ...|   .:|.|         ...||     |. |:|.....::..:||.|:     ..:..:|.
Mouse   189 GEAC---GQCGLGYFEAERNSSHLVCSACFGPC-ARCTGPEESHCLQCKKGW-----ALHHLKCV 244

  Fly   657 DIDECQVIPGLC--QQKCLNFWGGYRCTCNSGYQLGPDNRTCNDINECEVHKDYKLCMGLCINTP 719
            |||||......|  .|.|:|..|.|.|            |.|           .|.|:|.....|
Mouse   245 DIDECGTEQATCGADQFCVNTEGSYEC------------RDC-----------AKACLGCMGAGP 286

  Fly   720 GSYQC-SCPRGYILAADMNTCRDVDECATDSINQVCTGRNDICTNIRGSYKCTTVNCPLGYSIDP 783
            |  :| .|.|||....  :.|.|||||.|    .||.|.|:.|.|..|.|:|.   |..||    
Mouse   287 G--RCKKCSRGYQQVG--SKCLDVDECET----VVCPGENEKCENTEGGYRCV---CAEGY---- 336

  Fly   784 EQKNRCRQNLNFCEGEE 800
                  ||....|..|:
Mouse   337 ------RQEDGICVKEQ 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31999NP_001284712.1 vWFA <189..227 CDD:294047
EGF_CA 251..293 CDD:238011
EGF_CA 328..>363 CDD:214542
EGF_CA 519..564 CDD:214542 7/18 (39%)
EGF_CA 565..601 CDD:238011 11/39 (28%)
EGF_CA 611..651 CDD:284955 10/53 (19%)
vWFA <655..695 CDD:294047 13/41 (32%)
cEGF 678..701 CDD:289433 4/22 (18%)
EGF_CA 698..>730 CDD:214542 8/32 (25%)
cEGF 721..744 CDD:289433 8/23 (35%)
Creld1NP_598691.1 DUF3456 46..>100 CDD:371810
CXXC. /evidence=ECO:0000250|UniProtKB:Q19267 46..49
FU 1 208..255 14/52 (27%)
FU 210..245 CDD:214589 9/40 (23%)
EGF_CA 245..>272 CDD:389777 12/38 (32%)
FU 2 268..315 22/77 (29%)
CXXC. /evidence=ECO:0000250|UniProtKB:Q9CYA0 278..281 1/2 (50%)
EGF_CA 305..337 CDD:214542 18/48 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.