DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31999 and COL6A3

DIOPT Version :9

Sequence 1:	NP_001284712.1	Gene:	CG31999 / 43777	FlyBaseID:	FBgn0051999	Length:	917	Species:	Drosophila melanogaster
Sequence 2:	NP_004360.2	Gene:	COL6A3 / 1293	HGNCID:	2213	Length:	3177	Species:	Homo sapiens

Alignment Length:	121	Identity:	27/121 - (22%)
Similarity:	40/121 - (33%)	Gaps:	34/121 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   665 PGLCQQKCLNFWGGYRCTCNSGY--QLGPDNRTCNDINECEVHKDYK----LCMGLCINTPGSYQ 723
            ||:..||           .:.||  ..||.....:.|::|.:.:..|    .|.|         .
Human  2349 PGIVGQK-----------GDPGYPGPAGPKGNRGDSIDQCALIQSIKDKCPCCYG---------P 2393

  Fly   724 CSCPRGYILAADMNTCRDVDECATDSINQVCTGR-NDICTNIRGSYKCTTVNCPLG 778
            ..||   :...::....|..|    .:||...|| .|:..:|.........|||.|
Human  2394 LECP---VFPTELAFALDTSE----GVNQDTFGRMRDVVLSIVNDLTIAESNCPRG 2442

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31999	NP_001284712.1	vWFA	<189..227	CDD:294047
		EGF_CA	251..293	CDD:238011
		EGF_CA	328..>363	CDD:214542
		EGF_CA	519..564	CDD:214542
		EGF_CA	565..601	CDD:238011
		EGF_CA	611..651	CDD:284955
		vWFA	<655..695	CDD:294047	8/31 (26%)
		cEGF	678..701	CDD:289433	5/24 (21%)
		EGF_CA	698..>730	CDD:214542	7/35 (20%)
		cEGF	721..744	CDD:289433	3/22 (14%)
COL6A3	NP_004360.2	Nonhelical region	26..2038
		vWFA	38..203	CDD:320736
		vWFA	241..405	CDD:320736
		vWA_collagen_alpha3-VI-like	444..608	CDD:238758
		vWA_collagen_alpha3-VI-like	638..802	CDD:238758
		vWFA	836..999	CDD:320736
		vWFA	1028..1191	CDD:320736
		vWA_collagen_alpha3-VI-like	1232..1394	CDD:238758
		vWA_collagen_alpha3-VI-like	1435..1599	CDD:238758
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1612..1634
		VWA	1639..1811	CDD:306576
		VWA	1838..1994	CDD:214621
		Triple-helical region	2039..2375		8/36 (22%)
		Cell attachment site	2040..2042
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2041..2369		8/30 (27%)
		Collagen	2080..2133	CDD:189968
		Collagen	2110..2172	CDD:189968
		Cell attachment site	2136..2138
		Cell attachment site	2148..2150
		Cell attachment site	2154..2156
		Collagen	2183..2292	CDD:189968
		Collagen	2270..2338	CDD:189968
		Collagen	2314..2371	CDD:189968	8/32 (25%)
		Cell attachment site	2370..2372		0/1 (0%)
		Nonhelical region	2376..3177		18/83 (22%)
		VWA	2403..2580	CDD:306576	12/44 (27%)
		VWA	2619..2806	CDD:306576
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2859..2890
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2957..2986
		FN3	2993..3061	CDD:214495
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3073..3093
		Kunitz_BPTI	3111..3162	CDD:278443
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000