DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31999 and LOC101884488

DIOPT Version :9

Sequence 1:NP_001284712.1 Gene:CG31999 / 43777 FlyBaseID:FBgn0051999 Length:917 Species:Drosophila melanogaster
Sequence 2:XP_005170297.2 Gene:LOC101884488 / 101884488 -ID:- Length:655 Species:Danio rerio


Alignment Length:364 Identity:87/364 - (23%)
Similarity:116/364 - (31%) Gaps:133/364 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 CSPGFYRNTLGACIDTNECMEQNPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKSCIDIDEC 569
            |..|:.||:...|....|    :.| .|..|:   |..:|    .|.|||    .||:|      
Zfish    33 CVFGWMRNSNAQCRPVCE----SGC-KHGECV---GPDQC----LCHPGY----TGKTC------ 75

  Fly   570 DTGEHNCGERQICRNRNGGFVCSCPIGHELKRSIGGASTCVDTNECALEQRVCPLNAQCFNTIGA 634
                     ||                              |.||||..    |...:|.||:|:
Zfish    76 ---------RQ------------------------------DVNECAFR----PCKHRCMNTLGS 97

  Fly   635 YYCECKAGFQKKSDGNNSTQCFDIDECQVIPGLCQQKCLNFWGGYRCTCNS-GYQLGPDNRTCND 698
            |.|.|..||...:||:    |.:...|.:  ..||..|....|..||.|.| |.:|..|.|||.|
Zfish    98 YKCYCLEGFMLTADGS----CKNTRTCAM--ANCQYGCAVLKGVVRCQCPSPGLKLAVDGRTCVD 156

  Fly   699 INECEVHKDYKLCMGL--------CINTPGSYQCSCPRGYILAADMNTCRDVDECATDSINQVCT 755
            ::||        ..||        |:||.|||.|.|..|:.|                       
Zfish   157 VDEC--------VSGLASCPRFRKCVNTFGSYVCRCHEGFHL----------------------- 190

  Fly   756 GRNDICTNIRGSYKCTTVNCPLGYSIDPEQKNRCRQNLNFCEGEECYTQPSAFTYNFITFVSKLM 820
                  .:..|.|.||  :..|....|.....:|:          |....|...|:..:.|...:
Zfish   191 ------QHFNGKYHCT--DRKLSICSDKPGHKKCK----------CTASISGKGYDCKSVVKVTI 237

  Fly   821 IPPDGRTIFTLRGPLWYDNIEFDLKIVRIQATTNIQKAT 859
            .|....|:    .|.........:...::|..|.|..||
Zfish   238 EPAKPVTV----SPTTISMATTSMTTTKVQPKTTITMAT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31999NP_001284712.1 vWFA <189..227 CDD:294047
EGF_CA 251..293 CDD:238011
EGF_CA 328..>363 CDD:214542
EGF_CA 519..564 CDD:214542 12/44 (27%)
EGF_CA 565..601 CDD:238011 2/35 (6%)
EGF_CA 611..651 CDD:284955 17/39 (44%)
vWFA <655..695 CDD:294047 13/40 (33%)
cEGF 678..701 CDD:289433 11/23 (48%)
EGF_CA 698..>730 CDD:214542 13/39 (33%)
cEGF 721..744 CDD:289433 6/22 (27%)
LOC101884488XP_005170297.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11922
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.