DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crk and grap2a

DIOPT Version :10

Sequence 1:NP_651908.1 Gene:Crk / 43775 FlyBaseID:FBgn0024811 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001017756.1 Gene:grap2a / 550452 ZFINID:ZDB-GENE-050417-275 Length:284 Species:Danio rerio


Alignment Length:237 Identity:56/237 - (23%)
Similarity:82/237 - (34%) Gaps:86/237 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DRN--SWYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNYIINKVQQQDQ 70
            ||.  ||:....||..|.|.||: ||.|.||:|.|.|..||:.:.||.|..|.::   ||.:...
Zfish    52 DRQIPSWFKESASRGSAEETLMS-REVGAFLIRGSQSSPGDFSISVRHDYDVQHF---KVMKDKS 112

  Fly    71 IVYRIGDQSFDNLPKLLTFY--------------------------------------------- 90
            ..|.:..:.|.:|.||:.||                                             
Zfish   113 GHYYLWTEKFTSLNKLVDFYKTTSISKQKEIFLRDGSGDEPRAPPPIKSQPEVRPPPGGGYGSPQ 177

  Fly    91 ---------------------------TL-HYLDTTPLKR------PACRRVEKVIGKFDFVGSD 121
                                       || |....:|..|      ||.|...:|...:||...:
Zfish   178 TSSQNRSTTDPTHNQKGKRGSVEEKSNTLGHQGKNSPAPRRTSETAPAPRSTIQVRAIYDFTAEE 242

  Fly   122 QDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQ 163
            .|:|.|..|:::.::.:.:..||..| ..|:.|..|..|.:|
Zfish   243 DDELGFNSGDIIEVLDRSDASWWKGR-LRGRSGLFPANYTEQ 283

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CrkNP_651908.1 SH2_CRK_like 4..108 CDD:198180 41/180 (23%)
SH3_CRK_N 109..163 CDD:212692 14/53 (26%)
SH3_CRK_C 201..257 CDD:212693