DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crk and crkl

DIOPT Version :9

Sequence 1:NP_651908.1 Gene:Crk / 43775 FlyBaseID:FBgn0024811 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_989060.1 Gene:crkl / 394657 XenbaseID:XB-GENE-976114 Length:289 Species:Xenopus tropicalis


Alignment Length:179 Identity:91/179 - (50%)
Similarity:119/179 - (66%) Gaps:23/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDVSDRNSWYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNYIINKVQQQ 68
            ||.|||:.|||||:|||:|...|..:| .||||||||::..||:||.|.|:::||:||||.:..:
 Frog     6 FDSSDRSGWYFGPVSRQEAQSRLQGQR-HGVFLVRDSSTCPGDHVLSVSENSRVSHYIINSLPGR 69

  Fly    69 DQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACR-------------------RVEKVIGK 114
            .   |:||||.|||||.||.||.:||||||.|..||.|                   .:|.|...
 Frog    70 R---YKIGDQEFDNLPALLDFYKIHYLDTTTLIEPAPRYPSPPVGTGTAPSVPVPEENLEYVRTL 131

  Fly   115 FDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQ 163
            :||.|:|.:||||::||:|.||.|.|:|||:|||..|:||.|||||:::
 Frog   132 YDFPGNDAEDLPFKKGEILVIVEKPEEQWWSARNKDGRIGMIPVPYVEK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrkNP_651908.1 SH2_CRK_like 4..108 CDD:198180 60/122 (49%)
SH3_CRK_N 109..163 CDD:212692 31/53 (58%)
SH3_CRK_C 201..257 CDD:212693
crklNP_989060.1 SH2_CRK_like 6..106 CDD:198180 60/103 (58%)
SH3_CRK_N 126..180 CDD:212692 31/53 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7815
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I3131
OMA 1 1.010 - - QHG52661
OrthoDB 1 1.010 - - D1414461at2759
OrthoFinder 1 1.000 - - FOG0003539
OrthoInspector 1 1.000 - - otm47556
Panther 1 1.100 - - LDO PTHR19969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.