DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crk and dock

DIOPT Version :9

Sequence 1:NP_651908.1 Gene:Crk / 43775 FlyBaseID:FBgn0024811 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster


Alignment Length:185 Identity:45/185 - (24%)
Similarity:82/185 - (44%) Gaps:51/185 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VIGKFDFVGSDQDDLPFQRGEVLTIVRK--DEDQWWTARNSSGKIGQIPVPYIQQYDDYM----- 168
            |:..:.|..::..:|.|::|:.|.||.:  .:..|:.|||:.|::|.:|..|:|:.:||:     
  Fly   329 VVALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYR 393

  Fly   169 ----------------------DEDAIDK----NEPSISGSSNVFESTLKRTDLNRKLPAYARVK 207
                                  ..|::::    |:|:...|....|    |.:|..|...|..:.
  Fly   394 NASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIE----RPNLAGKSWYYGAIT 454

  Fly   208 QSR---VPNAYDKTALKLEIGD-IIKVTKTNINGQWEGELN--GKNGHFPFTHVE 256
            :|:   |.|.:...      || :|:.::||: |.:...|.  |:|.||. .|||
  Fly   455 RSQCDTVLNGHGHD------GDFLIRDSETNM-GDYSVSLKAPGRNKHFR-VHVE 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrkNP_651908.1 SH2_CRK_like 4..108 CDD:198180
SH3_CRK_N 109..163 CDD:212692 16/53 (30%)
SH3_CRK_C 201..257 CDD:212693 18/62 (29%)
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701 16/53 (30%)
SH2_Nck_family 446..538 CDD:198196 19/64 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.