DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABCD and LOC101882118

DIOPT Version :9

Sequence 1:NP_001245409.1 Gene:ABCD / 43772 FlyBaseID:FBgn0039890 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_005174656.2 Gene:LOC101882118 / 101882118 -ID:- Length:385 Species:Danio rerio


Alignment Length:360 Identity:194/360 - (53%)
Similarity:245/360 - (68%) Gaps:33/360 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 MVSLPILTGSDVGLGTVPNTAI---SESRVSERTQYLTTARNLLISAADAIERLMSSYKEIVSLA 445
            ||::||:|.:    |...|...   ::..|||||:..|||||||.|.||||||:||||||:..||
Zfish     1 MVAVPIITAT----GFADNELADGQTQVLVSERTEAFTTARNLLASGADAIERIMSSYKEVTELA 61

  Fly   446 GYTFRVAGMMDVFEETALGVY------CKTSVMES-NQSNGIIEFRNGKPIAKGRIIYSDDPKNM 503
            |||.||..|..||:|...|:|      |.|..|.| :|:...|:   |....||::|..|    .
Zfish    62 GYTARVHNMFLVFDEVQRGLYKRSSAACSTGEMISGDQAEMHID---GPRQIKGKVIDVD----K 119

  Fly   504 SISLRAVPVVTPNCDIVVPKLTLCIEPGVHLLITGPNGCGKSSLFRILSGLWPIYAGELHIPRPV 568
            .|....||::|||.|:||..|...:|.|:||||||||||||||||||||||||:|.|.||.|.|.
Zfish   120 GIVCEQVPIITPNGDVVVSCLNFKVEEGMHLLITGPNGCGKSSLFRILSGLWPVYGGLLHKPSPE 184

  Fly   569 KDVPCMFYIPQRPYMSIGSLCDQIIYPDTREDMKRKHITENELRSILKMVSLEHIAQRD-SFDVV 632
            .    |||||||||||||:|.||:||||:.:||..|...:.||..||.:|:|.||..|: .:|..
Zfish   185 H----MFYIPQRPYMSIGTLRDQVIYPDSLDDMHSKGYRDKELEVILDIVNLNHIVTREGGWDAE 245

  Fly   633 RDWKDILSGGEKQRMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGMGITLLTITHRPTL 697
            .||||:|||||||||.:||:|||:|:||||||||||||||||..|::.||..||:||:|||||:|
Zfish   246 MDWKDVLSGGEKQRMGMARMFYHKPKYALLDECTSAVSIDVEGKIFQAAKDAGISLLSITHRPSL 310

  Fly   698 WKYHTHILEFDGLGNWQFRKMN-------SDEEQK 725
            ||||||:|:|||.|.|:|.:::       ::|:|:
Zfish   311 WKYHTHLLQFDGEGGWRFEQLDTATRLSLTEEKQR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABCDNP_001245409.1 3a01203 75..715 CDD:273360 191/341 (56%)
LOC101882118XP_005174656.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594203
Domainoid 1 1.000 193 1.000 Domainoid score I3148
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146647at33208
OrthoFinder 1 1.000 - - FOG0000393
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.