DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and ARFD1B

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_171745.3 Gene:ARFD1B / 839242 AraportID:AT1G02430 Length:190 Species:Arabidopsis thaliana


Alignment Length:276 Identity:67/276 - (24%)
Similarity:100/276 - (36%) Gaps:120/276 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVMLGLDSAGKTTALYRLKFDQYL-NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQE--KLRP 89
            :|:.|||:|||::.:::||..:.| .|:||||.:.|.|     |.|..:...|::|||:  |..|
plant    20 IVLFGLDAAGKSSIMHKLKTGETLTTTMPTIGTDVESV-----KYKDSNLRFWEMGGQQCYKWFP 79

  Fly    90 LWRSYTRCTDGILFVIDSVDTERMEEAKMELMRT-----AKCPDNQGVPVLILANKQDLPNACGA 149
            :.:...:...|::.|:||.|.:|:|:||..|...     ...|||  |.||:..||.::|.|..|
plant    80 MTKHDFQEIAGLVLVVDSTDRDRIEDAKDFLNAVIDEIQGSVPDN--VAVLVFGNKHEVPGAMSA 142

  Fly   150 MELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKP 214
            .|:...|.|..                                                      
plant   143 SEISNKLDLTS------------------------------------------------------ 153

  Fly   215 ALESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQP 279
                                          |.|||.|                     |.|::|.
plant   154 ------------------------------LRQKNWQ---------------------RNWHVQS 167

  Fly   280 TCAITGEGLQEGLDAL 295
            :||.:|:||.||||.|
plant   168 SCAFSGDGLHEGLDWL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 67/276 (24%)
ARFD1BNP_171745.3 Arf_Arl 19..186 CDD:206644 67/276 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.