DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and Arl4d

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_079680.1 Gene:Arl4d / 80981 MGIID:1933155 Length:201 Species:Mus musculus


Alignment Length:286 Identity:110/286 - (38%)
Similarity:142/286 - (49%) Gaps:108/286 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPL 90
            ||||::||||||||:.||||||.:::.:|||.|||.||::..||.::|:.|.|||||||||||||
Mouse    22 LHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPL 86

  Fly    91 WRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKL 155
            ||||||.|||::||:||.:|||:|||:|||.|.:|..||||||||:||||||.|.|..|.|:||.
Mouse    87 WRSYTRRTDGLVFVVDSAETERLEEARMELHRISKASDNQGVPVLVLANKQDQPGALSAAEVEKR 151

  Fly   156 LGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKD 220
            |.:.|                                                            
Mouse   152 LAVRE------------------------------------------------------------ 156

  Fly   221 HNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITG 285
                |:...||                                            ::|...|:.|
Mouse   157 ----LAAATLT--------------------------------------------HVQGCSAVDG 173

  Fly   286 EGLQEGLDALYDMILKRRKINKSNKR 311
            .|||.||:.||:|||||:|..:|:|:
Mouse   174 LGLQPGLEHLYEMILKRKKAPRSSKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 109/284 (38%)
Arl4dNP_079680.1 Arl4_Arl7 19..201 CDD:206719 110/286 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 197 1.000 Domainoid score I3103
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457094at2759
OrthoFinder 1 1.000 - - FOG0002276
OrthoInspector 1 1.000 - - otm42926
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1505
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.