DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and ARL14

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_079323.1 Gene:ARL14 / 80117 HGNCID:22974 Length:192 Species:Homo sapiens


Alignment Length:283 Identity:80/283 - (28%)
Similarity:113/283 - (39%) Gaps:112/283 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEK 86
            |.....|::||||||||:|.||:||..:.:.|:||||||.|.::.    .:.:...|||||||||
Human    10 QTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIEL----ERNLSLTVWDVGGQEK 70

  Fly    87 LRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAME 151
            :|.:|..|...|||:::|:||.|.:|:||::.:.....|....:.|||::||||||:|       
Human    71 MRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMP------- 128

  Fly   152 LEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPAL 216
                                                                             
Human   129 ----------------------------------------------------------------- 128

  Fly   217 ESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTC 281
                       |||||                  :|:...|..||:       ...|.||:||.|
Human   129 -----------GALTA------------------EDITRMFKVKKL-------CSDRNWYVQPCC 157

  Fly   282 AITGEGLQEGLDALYDMILKRRK 304
            |:|||||.:|...|...:....|
Human   158 ALTGEGLAQGFRKLTGFVKSHMK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 79/281 (28%)
ARL14NP_079323.1 SAR 1..175 CDD:197556 79/276 (29%)
ARLTS1 15..174 CDD:133356 78/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587782at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.