DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and Arl5a

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_892039.1 Gene:Arl5a / 75423 MGIID:1922673 Length:179 Species:Mus musculus


Alignment Length:278 Identity:69/278 - (24%)
Similarity:102/278 - (36%) Gaps:118/278 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWR 92
            |:::|||:|||||.||:...::.::|.||||.|.|::     ......||:||:||||.|||.|.
Mouse    19 VIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEI-----VVNNTRFLMWDIGGQESLRPSWN 78

  Fly    93 SYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLG 157
            :|...|:.::.|:||.|.||:...:.||.:.....|.:...:||.|||||:.......|:.:.|.
Mouse    79 TYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLK 143

  Fly   158 LNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKDHN 222
            |..:                                                         |||.
Mouse   144 LTSI---------------------------------------------------------KDHQ 151

  Fly   223 STLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITGEG 287
                                                                |:||..||:||||
Mouse   152 ----------------------------------------------------WHIQACCALTGEG 164

  Fly   288 LQEGLDALYDMILKRRKI 305
            |.:||    :.::.|.||
Mouse   165 LCQGL----EWMMSRLKI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 69/278 (25%)
Arl5aNP_892039.1 Arl5_Arl8 3..175 CDD:133353 66/273 (24%)
Ras 18..164 CDD:278499 61/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.