DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arl9

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001038852.1 Gene:arl9 / 751670 ZFINID:ZDB-GENE-060825-210 Length:241 Species:Danio rerio


Alignment Length:146 Identity:53/146 - (36%)
Similarity:75/146 - (51%) Gaps:18/146 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QVATLHVVMLGLDSAGKTTALYRLKFDQYLNTV-PTIGFNC-----EKVQCTLGKAKGVHFLVWD 80
            :.|...|::||||.||||:.|:..........| ||.|||.     |.:|        :.||  :
Zfish    70 RTAGTQVLVLGLDGAGKTSLLHCFATGSLEQDVSPTQGFNAVSINKEDLQ--------IEFL--E 124

  Fly    81 VGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPN 145
            :||.||||..||.|......::||:||.|.||...||..|.:....  :.|:|:::||||||:..
Zfish   125 IGGSEKLREYWRMYLSKARVLVFVVDSSDPERFPLAKHHLQQLLSA--DPGLPLVLLANKQDVSG 187

  Fly   146 ACGAMELEKLLGLNEL 161
            |.|..:|.:.|.|..:
Zfish   188 ARGITDLYEALDLGNV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 53/144 (37%)
arl9NP_001038852.1 P-loop_NTPase 75..239 CDD:304359 52/141 (37%)
Gem1 75..>184 CDD:224025 45/120 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.