DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arl5c

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001037909.1 Gene:arl5c / 733518 XenbaseID:XB-GENE-5898153 Length:179 Species:Xenopus tropicalis


Alignment Length:285 Identity:74/285 - (25%)
Similarity:111/285 - (38%) Gaps:116/285 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GNILDALPSQVATLH--VVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVH 75
            |||...:.|......  |:::|||:|||||.||:...::.::|.||||.|.|::     .::..|
 Frog     2 GNIFTRIMSIFGNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTAPTIGSNVEEI-----ISRNTH 61

  Fly    76 FLVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANK 140
            ||:||:||||.||..|.||...|:.::.||||.|.||:.|.:.||.:.....:.:...:||.|||
 Frog    62 FLMWDIGGQETLRATWNSYYSNTEFVILVIDSTDRERLPETREELYKMLAHEELKDAAILIFANK 126

  Fly   141 QDLPNACGAMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHL 205
            ||                                                               
 Frog   127 QD--------------------------------------------------------------- 128

  Fly   206 HSSMIHIKPALESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSV 270
                  :|.::.:.:.:|:|:.||                                        :
 Frog   129 ------VKDSMTASEISSSLALGA----------------------------------------I 147

  Fly   271 QFRGWYIQPTCAITGEGLQEGLDAL 295
            :.|.|:||..||:|||||..|||.|
 Frog   148 RDRAWHIQGCCALTGEGLPAGLDWL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 70/274 (26%)
arl5cNP_001037909.1 Arl5_Arl8 3..175 CDD:133353 73/284 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.