DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and Arl14

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_082119.1 Gene:Arl14 / 71619 MGIID:1918869 Length:192 Species:Mus musculus


Alignment Length:295 Identity:85/295 - (28%)
Similarity:121/295 - (41%) Gaps:113/295 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILDALPSQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVW 79
            :|::...|....|:::||||||||:|.||||||.:.|:|:||||||.|.||.    ...:...||
Mouse     3 LLNSKNPQSKQAHILLLGLDSAGKSTLLYRLKFAETLSTIPTIGFNVEMVQL----QSSLTLTVW 63

  Fly    80 DVGGQEKLRPLWRSYTRCTDGILFVID-SVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDL 143
            |||||||:|.:|..|.....|:::|:| |...:|:|:::.|.....|....:..||:||||||||
Mouse    64 DVGGQEKMRTVWDCYCENAQGLMYVVDCSEGKKRLEDSRKEFKHILKNEHIKNTPVVILANKQDL 128

  Fly   144 PNACGAMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSS 208
            |                                                                
Mouse   129 P---------------------------------------------------------------- 129

  Fly   209 MIHIKPALESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFR 273
                               |||:|                  :|:...|..||:   .||    |
Mouse   130 -------------------GALSA------------------EDITRMFKVKKL---CSN----R 150

  Fly   274 GWYIQPTCAITGEGLQEGLDALYDMILKRRKINKS 308
            .||:||.||:|||||.:|...|.:.:...|:..::
Mouse   151 NWYVQPCCAVTGEGLDDGFRKLTEFLKSYRRTRET 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 83/286 (29%)
Arl14NP_082119.1 SAR 1..176 CDD:197556 84/284 (30%)
ARLTS1 15..175 CDD:133356 82/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587782at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.