DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and Arl6

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001334173.1 Gene:Arl6 / 56297 MGIID:1927136 Length:193 Species:Mus musculus


Alignment Length:291 Identity:76/291 - (26%)
Similarity:109/291 - (37%) Gaps:122/291 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILDALPSQVA----TLHVVMLGLDSAGKTTALYRLKFD--QYLNTVPTIGFNCEKVQCTLGKAKG 73
            :||.|...:.    .:||:.||||::||||.:.:||..  |..:.||||||:.||.     |:..
Mouse     3 LLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKF-----KSSS 62

  Fly    74 VHFLVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPD--NQGVPVLI 136
            :.|.|:|:.||.:.|.||..|.:....|:|||||.|..||..||.||......||  ::.:|:|.
Mouse    63 LSFTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILF 127

  Fly   137 LANKQDLPNACGAMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKK 201
            .|||.||.::..::::.:||.|                               :||.||.     
Mouse   128 FANKMDLRDSVTSVKVSQLLCL-------------------------------ESIKDKP----- 156

  Fly   202 ESHLHSSMIHIKPALESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSS 266
                                                                             
Mouse   157 ----------------------------------------------------------------- 156

  Fly   267 SNSVQFRGWYIQPTCAITGEGLQEGLDALYD 297
                    |:|..:.||.|||||||:|.|.:
Mouse   157 --------WHICASDAIKGEGLQEGVDWLQE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 73/282 (26%)
Arl6NP_001334173.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.