DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arl14

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001093453.1 Gene:arl14 / 556921 ZFINID:ZDB-GENE-070705-288 Length:201 Species:Danio rerio


Alignment Length:272 Identity:73/272 - (26%)
Similarity:112/272 - (41%) Gaps:109/272 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWR 92
            :::||||:|||:|.||:||:|:..:||||||||.|.::....:.| :...|||||||.|:|..||
Zfish    14 ILLLGLDNAGKSTLLYKLKYDENFHTVPTIGFNVEMIEAKKNRDK-ISLTVWDVGGQAKMRAFWR 77

  Fly    93 SYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLG 157
            ::.:.|.||:||:||.|.:|::|||..|.::.:....:|:||::||||||:..|....|:.:...
Zfish    78 NFYQDTAGIVFVVDSSDVKRLDEAKGVLEQSLRSEHLRGLPVVVLANKQDIVGAATVTEITEQFN 142

  Fly   158 LNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKDHN 222
            |.:           |.||                                               
Zfish   143 LRK-----------SCSD----------------------------------------------- 149

  Fly   223 STLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITGEG 287
                                                              |.|:|||..|:||.|
Zfish   150 --------------------------------------------------RDWFIQPCSALTGAG 164

  Fly   288 LQEGLDALYDMI 299
            |.:|...:..::
Zfish   165 LVDGFRRMAHLV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 73/272 (27%)
arl14NP_001093453.1 SAR 11..176 CDD:197556 73/270 (27%)
P-loop_NTPase 13..175 CDD:304359 73/269 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587782at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.