DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and zgc:110286

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001017602.1 Gene:zgc:110286 / 550265 ZFINID:ZDB-GENE-050417-68 Length:181 Species:Danio rerio


Alignment Length:294 Identity:87/294 - (29%)
Similarity:117/294 - (39%) Gaps:118/294 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GNILDALPSQV----ATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKG 73
            ||....|.|::    ..:.:||:|||:|||||.||:||..:.::|:||||||.|.|:     .|.
Zfish     2 GNFFSQLFSRLFEGKKQIRLVMVGLDAAGKTTVLYKLKLGEVVSTIPTIGFNVETVE-----YKN 61

  Fly    74 VHFLVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILA 138
            :.|.|||||||.|:|.||:.|.:.:.|::||:||.|.||:|.|..||.......:.:...:|:||
Zfish    62 ISFTVWDVGGQTKIRGLWKYYYQYSQGLIFVVDSSDHERIETAAEELNAMLAEDEMRDAVLLVLA 126

  Fly   139 NKQDLPNACGAMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKES 203
            ||||||.|....||...|||.                                            
Zfish   127 NKQDLPKAMPVHELTDRLGLR-------------------------------------------- 147

  Fly   204 HLHSSMIHIKPALESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSN 268
                                     |||.                                    
Zfish   148 -------------------------ALTG------------------------------------ 151

  Fly   269 SVQFRGWYIQPTCAITGEGLQEGLDALYDMILKR 302
                |.|::|.|||:.|.||.||||.|.:.:.||
Zfish   152 ----RQWFVQSTCAVQGSGLYEGLDWLSNQLYKR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 83/279 (30%)
zgc:110286NP_001017602.1 P-loop_NTPase 1..181 CDD:304359 85/292 (29%)
SAR 3..175 CDD:197556 83/285 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.