DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arl4c

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001016707.1 Gene:arl4c / 549461 XenbaseID:XB-GENE-998820 Length:193 Species:Xenopus tropicalis


Alignment Length:299 Identity:115/299 - (38%)
Similarity:150/299 - (50%) Gaps:109/299 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GNILDALPSQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFL 77
            |||...: |...:||:||||||||||||.||||||::::|||||||||.|:::.:.|.|||:...
 Frog     2 GNISSNI-SSFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTERIRLSNGAAKGISCH 65

  Fly    78 VWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQD 142
            .|||||||||||||:||:||||||::|:||||::|:||||.||.:..|..:|.|.|:|::|||||
 Frog    66 FWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDSDRLEEAKTELHKVTKFAENLGTPLLVIANKQD 130

  Fly   143 LPNACGAMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHS 207
            ||.:....|:|:.|.|.||            |.|:|                             
 Frog   131 LPKSLAVPEIERQLALQEL------------SPSTP----------------------------- 154

  Fly   208 SMIHIKPALESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQF 272
                                                                             
 Frog   155 ----------------------------------------------------------------- 154

  Fly   273 RGWYIQPTCAITGEGLQEGLDALYDMILKRRKINKSNKR 311
              :::||.|||.||||.||:|.||:|||||||..|..|:
 Frog   155 --YHVQPACAIIGEGLTEGMDKLYEMILKRRKTLKQKKK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 110/286 (38%)
arl4cNP_001016707.1 Arl4_Arl7 11..193 CDD:206719 111/289 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 194 1.000 Domainoid score I3114
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3747
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457094at2759
OrthoFinder 1 1.000 - - FOG0002276
OrthoInspector 1 1.000 - - otm48051
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5004
SonicParanoid 1 1.000 - - X1505
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.