DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arl14

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001015791.1 Gene:arl14 / 548508 XenbaseID:XB-GENE-5750500 Length:201 Species:Xenopus tropicalis


Alignment Length:293 Identity:78/293 - (26%)
Similarity:116/293 - (39%) Gaps:115/293 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQE 85
            |:|....:::||||.|||:|.||:.||.:...|:||:|||.|.:.    ..|.:...:||||||:
 Frog     9 SKVKQARILILGLDDAGKSTVLYKFKFKEPFITIPTVGFNVEMIH----TEKHLQLTMWDVGGQQ 69

  Fly    86 KLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAM 150
            |||..|..|...|||:::|:||.|::.::|:|.|.....:....:.|||::||||||||      
 Frog    70 KLRSFWCHYFENTDGLVYVVDSNDSKHLDESKKEFQHVLQNELIKDVPVVLLANKQDLP------ 128

  Fly   151 ELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPA 215
                                                                             
 Frog   129 ----------------------------------------------------------------- 128

  Fly   216 LESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPT 280
                        |||                  |.:::...|:.||.       ...|.||:||.
 Frog   129 ------------GAL------------------NAEEITRKFNMKKY-------CSDRDWYVQPC 156

  Fly   281 CAITGEGLQEGLDALYDMILKRRKINKSNKRNL 313
            ||.||:||.|||..:.:.:   :...||.:.:|
 Frog   157 CAHTGQGLAEGLSKVTEFV---KNCMKSKEDSL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 75/286 (26%)
arl14NP_001015791.1 ARLTS1 15..174 CDD:133356 73/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587782at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.