DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arl6

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_021329928.1 Gene:arl6 / 494134 ZFINID:ZDB-GENE-041219-2 Length:194 Species:Danio rerio


Alignment Length:278 Identity:72/278 - (25%)
Similarity:103/278 - (37%) Gaps:118/278 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LHVVMLGLDSAGKTTALYRLKFD--QYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLR 88
            ::|:.||||::||||.:.:||..  |..:.||||||:.||.     |...:.|.|:|:.||.:.|
Zfish    18 VNVLCLGLDNSGKTTIINQLKPSNAQAQDIVPTIGFSIEKF-----KTSSLSFTVFDMSGQGRYR 77

  Fly    89 PLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPD--NQGVPVLILANKQDLPNACGAME 151
            .||..|.:....|:|||||.|..||..||.||......||  ::.:|:|..|||.||.:|..|::
Zfish    78 NLWEHYYKEGQAIIFVIDSGDKLRMVVAKEELDTLLNHPDIKHRRIPLLFFANKMDLRDALSAVK 142

  Fly   152 LEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPAL 216
            :.:||.|                               ::|.||.                    
Zfish   143 VSQLLCL-------------------------------ENIKDKP-------------------- 156

  Fly   217 ESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTC 281
                                                                      |:|..:.
Zfish   157 ----------------------------------------------------------WHICASD 163

  Fly   282 AITGEGLQEGLDALYDMI 299
            |:.||||.||:|.|.:.|
Zfish   164 AVKGEGLLEGVDWLQEQI 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 72/278 (26%)
arl6XP_021329928.1 Arl6 19..180 CDD:206722 71/274 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.