DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arl5b

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001006744.1 Gene:arl5b / 448415 XenbaseID:XB-GENE-996906 Length:179 Species:Xenopus tropicalis


Alignment Length:266 Identity:72/266 - (27%)
Similarity:100/266 - (37%) Gaps:114/266 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWR 92
            |:::|||:|||||.||:...::.::|.||||.|.|::     ..|..|||:||:||||.||..|.
 Frog    19 VIIVGLDNAGKTTLLYQFLMNEVVHTSPTIGSNVEEI-----VVKNTHFLMWDIGGQESLRSSWN 78

  Fly    93 SYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLG 157
            :|...|:.|:.|:||.|.||:...|.||.|.....|.:...|||.|||||:.....|.::.|.|.
 Frog    79 TYYSNTEFIILVVDSTDRERLSITKEELYRMLAHEDLRKAAVLIFANKQDIKGCMSAADISKYLT 143

  Fly   158 LNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKDHN 222
            |:.:                                                         ||| 
 Frog   144 LSSI---------------------------------------------------------KDH- 150

  Fly   223 STLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITGEG 287
                                                               .|:||..||:||||
 Frog   151 ---------------------------------------------------PWHIQSCCALTGEG 164

  Fly   288 LQEGLD 293
            |.:||:
 Frog   165 LCQGLE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 72/266 (27%)
arl5bNP_001006744.1 Arl5_Arl8 3..175 CDD:133353 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.