DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arl4a

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001006711.1 Gene:arl4a / 448350 XenbaseID:XB-GENE-5783083 Length:200 Species:Xenopus tropicalis


Alignment Length:297 Identity:117/297 - (39%)
Similarity:148/297 - (49%) Gaps:109/297 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILDALPSQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVW 79
            ||..| |....||:.:||||.|||||.||||:|::::|||||.|||.||::.:||.:|.|.|..|
 Frog    11 ILSGL-SPFQALHIAILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNAEKIKVSLGNSKTVTFHFW 74

  Fly    80 DVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLP 144
            ||||||||||||:|||||||||:||:||||.|||||||.||.:..|..:||||||||:||||||.
 Frog    75 DVGGQEKLRPLWKSYTRCTDGIVFVVDSVDAERMEEAKTELHKITKISENQGVPVLIVANKQDLR 139

  Fly   145 NACGAMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSM 209
            |:....|:||||.|||..:..|                                           
 Frog   140 NSLTLSEIEKLLALNEFGSSTP------------------------------------------- 161

  Fly   210 IHIKPALESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRG 274
                                                                             
 Frog   162 ----------------------------------------------------------------- 161

  Fly   275 WYIQPTCAITGEGLQEGLDALYDMILKRRKINKSNKR 311
            |::|.||||.|:||:||::.||:||:||||:.:..|:
 Frog   162 WHLQATCAIIGDGLREGIEKLYEMIIKRRKMLRQQKK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 112/286 (39%)
arl4aNP_001006711.1 Arl4_Arl7 18..200 CDD:206719 113/289 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 194 1.000 Domainoid score I3114
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4194
Inparanoid 1 1.050 191 1.000 Inparanoid score I3747
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457094at2759
OrthoFinder 1 1.000 - - FOG0002276
OrthoInspector 1 1.000 - - otm48051
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5004
SonicParanoid 1 1.000 - - X1505
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.