DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and Arf102F

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster


Alignment Length:277 Identity:84/277 - (30%)
Similarity:113/277 - (40%) Gaps:114/277 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPL 90
            :.::|:|||:|||||.||:||..:.:.|:||||||.|.|:     .|.:.|.|||||||:|:|||
  Fly    18 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-----YKNICFTVWDVGGQDKIRPL 77

  Fly    91 WRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKL 155
            ||.|.:.|.|::||:||.|.:|:.||:.||....:..:.:...:|:.|||||||||..|.||...
  Fly    78 WRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDK 142

  Fly   156 LGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKD 220
            |.||:|.|                                                         
  Fly   143 LRLNQLRN--------------------------------------------------------- 150

  Fly   221 HNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITG 285
                                                                |.|:||.|||..|
  Fly   151 ----------------------------------------------------RHWFIQSTCATQG 163

  Fly   286 EGLQEGLDALYDMILKR 302
            .||.||||.|...:.|:
  Fly   164 HGLYEGLDWLSAELAKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 84/277 (30%)
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 83/275 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455870
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.