DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and dnd

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster


Alignment Length:144 Identity:60/144 - (41%)
Similarity:83/144 - (57%) Gaps:9/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PSQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQ 84
            |:......:::||||:|||||.|.:|..:......||.|||.:.|     .|.|....|||:|||
  Fly    12 PNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSV-----AADGFKLNVWDIGGQ 71

  Fly    85 EKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDN--QGVPVLILANKQDLPNAC 147
            .|:||.|::|...||.:::|||..|..|:.||..||.....  ||  :.|||||.|||||:|:|.
  Fly    72 WKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLM--DNRLKQVPVLIFANKQDMPDAM 134

  Fly   148 GAMELEKLLGLNEL 161
            .|.|:.:.:.|.:|
  Fly   135 SAAEVAEKMSLVQL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 59/140 (42%)
dndNP_650995.1 Arl3 3..176 CDD:206721 60/144 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.