DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arl10

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_989044.1 Gene:arl10 / 394641 XenbaseID:XB-GENE-945631 Length:237 Species:Xenopus tropicalis


Alignment Length:224 Identity:60/224 - (26%)
Similarity:102/224 - (45%) Gaps:58/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVMLGLDSAGKTTALYRLKFDQYLNT-----VPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKL 87
            :::||||.|||::.::.:.    .||     .||.|||..::     ..:|:...:.:|||.:.|
 Frog    48 ILVLGLDGAGKSSIIHAIS----TNTTRSSSAPTHGFNSAQI-----IHQGLRIELLEVGGSQNL 103

  Fly    88 RPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTA-KCPDNQGVPVLILANKQD------LPN 145
            |..|..|.:..:.|:||:||.|.:|:..|:.||.|.. :.||   :|:::||||||      ||.
 Frog   104 RTYWSQYLKNANVIVFVVDSTDNKRLHLARQELHRLLHEAPD---LPLMVLANKQDQNTALCLPE 165

  Fly   146 ACGAMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMI 210
            ....:.|.::.|..|                   :.|:|    ..:::|.:        .||:.:
 Frog   166 IHSELSLHRITGERE-------------------VTLLG----TSAVSDGA--------GHSTRL 199

  Fly   211 H-IKPALESKDHNSTLSGGALTAFIYPQS 238
            . :|..||.:.|..  .|.|.....:||:
 Frog   200 QTVKTLLEERLHRP--KGPAQNGANHPQA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 60/224 (27%)
arl10NP_989044.1 P-loop_NTPase 47..210 CDD:328724 55/204 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.