DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arf5

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_989018.1 Gene:arf5 / 394614 XenbaseID:XB-GENE-968852 Length:181 Species:Xenopus tropicalis


Alignment Length:274 Identity:85/274 - (31%)
Similarity:116/274 - (42%) Gaps:114/274 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPL 90
            :.::|:|||:|||||.||:||..:.:.|:||||||.|.|:     .|.:.|.|||||||:|:|||
 Frog    18 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-----YKNISFTVWDVGGQDKIRPL 77

  Fly    91 WRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKL 155
            ||.|.:.|.|::||:||.|.||:.||:.||||.....:.:...:|:.|||||||||..|.|:...
 Frog    78 WRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDK 142

  Fly   156 LGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKD 220
            |||                                                              
 Frog   143 LGL-------------------------------------------------------------- 145

  Fly   221 HNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITG 285
                                                           :|::.|.||||.|||.:|
 Frog   146 -----------------------------------------------HSLRHRNWYIQATCATSG 163

  Fly   286 EGLQEGLDALYDMI 299
            :||.||||.|.:.:
 Frog   164 DGLYEGLDWLSNQL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 85/274 (31%)
arf5NP_989018.1 ARF 5..179 CDD:128474 85/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.