DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and Arl5

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster


Alignment Length:280 Identity:75/280 - (26%)
Similarity:107/280 - (38%) Gaps:119/280 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWR 92
            :||:|||:|||||.||:...::.::|.||||.|.|:|..     :.:||||||:|||:.||..|.
  Fly    19 LVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVW-----RNIHFLVWDLGGQQSLRAAWS 78

  Fly    93 SYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLG 157
            :|...|:.::.||||.|.||:...:.||.|..:..|.....:|:.||||||..:..|.|:.:.|.
  Fly    79 TYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLD 143

  Fly   158 LNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKDHN 222
            |..:                                                         |.|.
  Fly   144 LTSI---------------------------------------------------------KKHQ 151

  Fly   223 STLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITGEG 287
                                                                |:||..||:||||
  Fly   152 ----------------------------------------------------WHIQACCALTGEG 164

  Fly   288 LQEGLDALYDMILKRRKINK 307
            |.:||    :.|::|.| ||
  Fly   165 LYQGL----EWIVQRIK-NK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 75/280 (27%)
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 71/273 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.