DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and ARL4D

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001652.2 Gene:ARL4D / 379 HGNCID:656 Length:201 Species:Homo sapiens


Alignment Length:286 Identity:106/286 - (37%)
Similarity:140/286 - (48%) Gaps:108/286 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPL 90
            ||||::||||||||:.||||||.:::.:|||.|||.||::..||.::|:.|.|||||||||||||
Human    22 LHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPL 86

  Fly    91 WRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKL 155
            ||||||.|||::||:|:.:.||:||||:||.|.::..||||||||:||||||.|.|..|.|:||.
Human    87 WRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKR 151

  Fly   156 LGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKD 220
            |.:.|                                                            
Human   152 LAVRE------------------------------------------------------------ 156

  Fly   221 HNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITG 285
                |:...||                                            ::|...|:.|
Human   157 ----LAAATLT--------------------------------------------HVQGCSAVDG 173

  Fly   286 EGLQEGLDALYDMILKRRKINKSNKR 311
            .|||:||:.||:|||||:|..:..|:
Human   174 LGLQQGLERLYEMILKRKKAARGGKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 105/284 (37%)
ARL4DNP_001652.2 P-loop_NTPase 19..201 CDD:422963 106/286 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 196 1.000 Domainoid score I3118
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457094at2759
OrthoFinder 1 1.000 - - FOG0002276
OrthoInspector 1 1.000 - - otm40854
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1505
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.