DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and ARF3

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001650.1 Gene:ARF3 / 377 HGNCID:654 Length:181 Species:Homo sapiens


Alignment Length:292 Identity:92/292 - (31%)
Similarity:126/292 - (43%) Gaps:116/292 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GNILDALPSQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFL 77
            ||:|.:|..: ..:.::|:|||:|||||.||:||..:.:.|:||||||.|.|:     .|.:.|.
Human     6 GNLLKSLIGK-KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-----YKNISFT 64

  Fly    78 VWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQD 142
            |||||||:|:|||||.|.:.|.|::||:||.|.||:.||:.||||.....:.:...:|:.|||||
Human    65 VWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQD 129

  Fly   143 LPNACGAMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHS 207
            ||||..|.|:...|||                                                 
Human   130 LPNAMNAAEITDKLGL------------------------------------------------- 145

  Fly   208 SMIHIKPALESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQF 272
                                                                        :|::.
Human   146 ------------------------------------------------------------HSLRH 150

  Fly   273 RGWYIQPTCAITGEGLQEGLDALYDMILKRRK 304
            |.||||.|||.:|:||.||||.|.:. ||.:|
Human   151 RNWYIQATCATSGDGLYEGLDWLANQ-LKNKK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 88/281 (31%)
ARF3NP_001650.1 P-loop_NTPase 5..179 CDD:422963 90/288 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.