DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and CG13692

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster


Alignment Length:187 Identity:36/187 - (19%)
Similarity:71/187 - (37%) Gaps:55/187 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VMLGLDSAGKTTALYRLK----FDQYLNTVPTIGFNCEKVQCTL--------------------- 68
            :.||...||||..|..|:    .|:...::||||....::....                     
  Fly     5 ICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGIYRIHFPTKSPNGDKNKPPPSEAPANIPH 69

  Fly    69 -GKAKGVHFLVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKM---ELMRTAKCPDN 129
             ||.......:.::||  .:.||||.|......:::|:|:.:..::..|.:   .::...:...|
  Fly    70 GGKNLPKSIQILEIGG--SMAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTEPRLQHN 132

  Fly   130 QGVPVLILAN-----KQDLPNACGAMELEKL------------------LGLNELYN 163
            ..: :|:||.     :|....|...::::||                  :||:.:|:
  Fly   133 TKI-LLVLAKMDYSYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYD 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 36/187 (19%)
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 36/187 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.