DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arl11

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_955987.1 Gene:arl11 / 324689 ZFINID:ZDB-GENE-030131-3410 Length:176 Species:Danio rerio


Alignment Length:159 Identity:60/159 - (37%)
Similarity:84/159 - (52%) Gaps:17/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGATMVKPLVKNGNILDALPSQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQ 65
            |||...|...|        |.|     |:::|||||||:|.:||......:.|.||:|||.    
Zfish     1 MGAIKSKRFKK--------PPQ-----VLIMGLDSAGKSTLMYRQLHGVIMQTSPTVGFNV---- 48

  Fly    66 CTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQ 130
            .||...|.....|||:|||:.:||.|:.|......::||:||.|..|:.||:..|.:.......:
Zfish    49 ATLQLNKKTSLTVWDIGGQDTMRPNWKYYLEGCKVLVFVVDSSDYARIGEAQKALKKILHDEHLK 113

  Fly   131 GVPVLILANKQDLPNACGAMELEKLLGLN 159
            |||:::||||:||||.....|:...|.|:
Zfish   114 GVPLMVLANKKDLPNTMTIREVSTKLDLD 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 53/136 (39%)
arl11NP_955987.1 small_GTP 12..166 CDD:272973 55/140 (39%)
ARLTS1 14..172 CDD:133356 54/138 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587782at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.